KEGG   Pyrenophora teres: PTT_07156Help
Entry
PTT_07156         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pte  Pyrenophora teres
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTT_07156
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_07156
   00020 Citrate cycle (TCA cycle)
    PTT_07156
   00620 Pyruvate metabolism
    PTT_07156
Enzymes [BR:pte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PTT_07156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 493 aa AA seqDB search
MPATTTLLSRARGQLASRGSIALRGAFSAAPCSQRTPALSALARYYASKSYPSHSVISMP
ALSPTMTSGNIGAWQKKVGDSIAPGDVLVEIETDKAQMDFEFQEEGTIAKILRDAGEKDV
AVGSPIAVMVDEGADISAFEGYTIEDAGGDKKPDTPSKEGEASEASEPPSSNSKTAPPAK
ESAPAAIESESTGDRLETALQRQPAISPAAKKLALEKGVPISSIKGTGKGGMVTKEDIEK
YKPAGGAPGSAAGVASYEDTEATSMRKVIASRLRESMNENPHYFVASNISVSKLLKLREA
LNASADGQYKLSVNDLLVKALAIAARKVPAANSSWREENGKVMIRQHNVVDVSVAVSTPV
GLMTPIVKNVNGLGLSSISSQIKDLGKRARDGKLKPEEYQGGTITISNMGMNPAVERFTA
VINPPQACIVAIGTTKKVAVPGEPSEDGTASIEWDDQIVITGSFDHKVVDGAVGGEFMRE
LKKAIENPLELML
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctaccacgacactgctatccagggcccgaggccaattggcctcgcggggctca
attgcgctgcgcggcgccttctctgccgcaccatgctcgcaacgcacacctgccctgtcc
gccctcgcgcggtactatgcctccaaatcctacccctcgcacagcgtcatcagcatgccc
gctctttccccgaccatgacctccggaaacattggcgcatggcagaagaaggtcggcgac
tcaatagcgcccggtgatgttctcgtcgaaatcgagacggacaaggcacagatggacttt
gagttccaggaggagggcaccattgccaagatcctccgcgacgctggcgagaaggacgtc
gctgttggaagccctattgccgtcatggtagacgagggcgctgatatctctgcattcgag
ggctacactatcgaggatgctggcggcgacaagaagcccgacaccccttcgaaagagggc
gaggcttcagaggccagcgagcccccaagctcaaactcaaagactgctcccccggccaag
gagtctgcacccgctgccatcgaatcagagtccaccggcgaccgtctagagaccgctctc
cagcgccagcctgccatctcccccgcggcgaagaagctcgcgctcgagaagggtgtgccg
attagctccatcaagggcactggcaagggtggcatggtcaccaaggaggacattgaaaag
tacaagcctgccggaggagcacccggctccgctgcaggtgttgccagttacgaagacacc
gaggccaccagcatgcgcaaggtcattgccagccgtctccgcgagagcatgaacgagaac
ccccactactttgtcgcctccaacatctccgtctccaagctcctcaagctccgtgaggct
ctcaacgcctcagctgacggtcagtacaagctctcagtcaacgacttgctcgtcaaggcc
ctcgctattgctgcccgcaaggtccccgctgccaactcatcatggcgcgaggagaacggc
aaggtcatgatccgacagcacaacgttgtcgatgtctctgtcgccgtctccaccccagtt
ggtctcatgactcctattgtcaagaacgtcaacggactcggcctctcttccatctcatca
caaatcaaggaccttggcaagcgcgcacgcgatggcaagctcaagcccgaagagtaccag
ggcggaaccattaccatttccaacatgggaatgaaccccgctgttgagcgcttcaccgcc
gtcatcaaccccccgcaagcatgcatcgtcgccattggcacaacaaagaaggttgccgta
cccggcgagccatcagaggacggcaccgccagcatcgagtgggacgaccagattgtcatc
accggtagcttcgaccacaaggttgtcgatggcgccgttggtggtgagtttatgcgcgag
ctcaagaaggcaattgagaaccctctggagcttatgctatag

DBGET integrated database retrieval system