KEGG   Pyrenophora teres: PTT_07246Help
Entry
PTT_07246         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pte  Pyrenophora teres
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PTT_07246
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PTT_07246
   00603 Glycosphingolipid biosynthesis - globo series
    PTT_07246
   00604 Glycosphingolipid biosynthesis - ganglio series
    PTT_07246
   00511 Other glycan degradation
    PTT_07246
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PTT_07246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 621 aa AA seqDB search
MRSLLPLCLLTSLTSALWPKPVSYENGKTVLFIAEDVPFNWYQTGTDVRFITDQVPFLFA
SKSNLGFASQNKTVSLKKTITQPASSDGAGDGGVSGDDIVNFAISSTWQTLFKRNLYPWK
FHPRSWSEPKPDGTGSVSRIDVKVLSANPDSIGKPLAGEVDESYSLTLTEDGVATINANS
SVGAAHGLTTLTQLFFAHSDKQHVYTNLAPVKITDSPKFQHRGINLDTSRAAFSVDDVKR
QIDACAYNKMNRFHLHVTDSQSWPLEVPSIPELSAKGAYRPDLVFTASDFQTMQRYAAIQ
GVQMITEIDMPGHTASIAYSFPDLITAFNIQPNWDTYAAEPPTGTLKLNSPKVSEFLNKL
LDDVLPRVSPYSAYFHTGGDEVNKNAYNLDDTVKSNDTAVLQPLMQKFVDRNHDQVRKLG
LTPVVWEEMLLDWNVTLGKDVIVQSWQSDAAVAQITAQGHKVLVGNYNYWYLDCGKGQWL
NFDPSIAASSYPYQDYCAPFHNWRLIYSYDPLAGVAPENQHLVLGGEAHMWSEQTDPINV
DRMIWPRAAAAAEILWSGAKDEQGRNRSQIDAAPRLSEMRERLVMRGVGAEPIQMPYCTM
EGTVCQLGFSGSGSGSGSGSG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgcttttacccttgtgtctcttgacgtctttaacgtctgctctatggccgaag
cctgtctcatatgagaacggcaagactgttctttttatcgcagaggacgtgccttttaac
tggtaccaaacagggacagatgtacgcttcataacagatcaagtcccttttctattcgca
tcaaagtctaaccttggcttcgcatcacagaataagacggtgtcgctgaagaagaccatc
acccagccagcatcaagtgatggagcaggagatggaggtgtatcaggagatgacattgta
aactttgctatcagctctacctggcaaacacttttcaagcgcaacctctatccatggaag
ttccacccccgtagctggtctgagcccaaaccagacggtacaggctccgtatctcgcatc
gacgtcaaggttctctctgccaatcctgacagcattggaaagccgcttgctggcgaggtc
gacgagtcatacagcctcacgttgacagaagatggagtggccaccattaacgcaaacagc
agtgtaggcgctgcccatggccttactaccttgacccaacttttctttgcccactctgac
aagcaacatgtatacacgaacctcgctccggtcaagattaccgacagccccaagtttcaa
caccgcggcatcaatcttgatacatcccgcgctgccttttccgtagacgatgtcaagcgc
caaattgatgcatgtgcgtacaacaagatgaatcgattccatctacatgtcacagacagc
cagtcatggccattggaagttccctcgatacccgagctatcagccaaaggagcctaccgc
cccgacctagtcttcacagctagcgacttccaaacaatgcaacgctacgctgccatccaa
ggcgtacaaatgatcaccgaaatcgacatgccaggccacaccgccagcatcgcctacagc
ttccccgacctaatcaccgccttcaacatccaaccaaactgggacacttacgcagccgag
ccccccaccggtactttgaagttaaactctcccaaggtatccgagtttctcaacaagctg
ctcgacgacgtgctaccccgtgtatccccttactcggcttacttccacaccggcggcgac
gaagtaaacaagaatgcgtacaacctcgatgatacggtcaagagcaacgacaccgccgtc
ctacaacctctaatgcaaaaattcgtagaccgcaaccacgaccaagtccgcaagttaggt
cttactcctgtggtttgggaggaaatgctgttggattggaacgttaccctcggcaaagac
gtcattgttcagtcctggcaaagcgacgctgcagtcgcccagatcacagcacagggccat
aaagtgcttgttggaaactacaactactggtatctagactgcggtaaaggccaatggcta
aacttcgacccctccatcgccgcctcatcctacccctaccaagactactgcgcccccttc
cacaactggcgcctaatctactcgtacgaccccctcgccggcgtcgccccagagaaccag
cacctcgttctcggcggcgaggcacacatgtggtctgagcaaactgaccccataaacgtc
gatcgcatgatctggccgcgcgctgcggccgcggccgagattctatggtccggggccaag
gacgagcagggtaggaatagaagtcagattgatgcggcgccgaggcttagcgagatgagg
gagaggttggtgatgaggggtgtgggcgcggagccgattcagatgccgtattgtactatg
gaggggactgtttgtcagttggggtttagtgggagcgggagcgggagcgggagcggtagt
gggtag

DBGET integrated database retrieval system