KEGG   Pyrenophora teres: PTT_07637Help
Entry
PTT_07637         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K03963  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
pte  Pyrenophora teres
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pte00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 94 aa AA seqDB search
MTITDTIKHAVGLDGEPRKATRQEMSAAKLPLAYRDSCAHLLIPLNRCRVEEYYLPWKCE
NERHSYEKCQYDEFKERVKKMDELRAAKNGERSN
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaccattaccgacacaatcaagcatgccgtcggccttgacggcgagccgagaaaggct
acccgccaggagatgagcgctgccaaactacccctagcctaccgagacagctgcgcacat
cttcttatcccgctgaaccggtgtcgggtcgaggagtactaccttccatggaagtgcgag
aacgagcgacattcgtatgaaaagtgccaatacgacgaattcaaggagcgcgtgaagaag
atggacgagctaagagcggctaagaacggggagcgcagtaactag

DBGET integrated database retrieval system