KEGG   Pyrenophora teres: PTT_07648Help
Entry
PTT_07648         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
pte  Pyrenophora teres
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:pte00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PTT_07648
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PTT_07648
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PTT_07648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1525 aa AA seqDB search
MSTQPRTSIRAMTPTNVPERSGSTVSEDSSGSSEDRVRKFQKTGEQGNRLRKTSASNAIT
AGRPLPPINHNPAGRGRAKVPLGPREPRQDFSKQRMTSGASLASVEGRSFLPTPANETTT
TTTTRLAPSNPRFSFSKQEQQHQQQLHHHHHQQQQQQHGQGQLESTKEELSESFGSYDFL
PSVNFDDFANRLAYEPTLSDFPVPGNFTSDVPAGNGQVQMQPFTSNPVDPYPTRTSSFAR
RFSQSTVRKASGGSTASGSDTSSMPPPPSNMAIRTRRQSQFPAQAPPNPAARPPRKSVGP
GMLPTNSFERDRANDNTMPRLTRAPSFSKGGRRETLSANLSTTTTGVPKLPTATRNAKAK
SLQPPSRHQSGHLTVSSNAPDLNPMPNNTRSPGRSPGAQPSYGTPSSANKRQSAAPHISG
LGARTISPTDARRLRRLSINPNHPPPGGPVGPPTPQADAAFDERAFSQSPAMVHGGNMTP
SSARATPEQKRKSYASGVSLSSNSSLNSLKVGPSSIPLRVNPAPSGSRLPAPKPRNVQSS
AGGEQEEVPPVPAIPKAYESPKEPERGSFTFTTAPSKMSTPQPVRQDAMATPEAQKPEAR
QSETSDGSFSNRSSGSIRHRRGLTVGNGPEQERTPTVQQSSKKSLQPIRLPPLNLLPLGT
PFNNRISSFPTPSGDLEEGAVTPPPKRALNKTPSTPMTASKANFFSRHTSHDEYHKHLRS
SSSAINLRQTDSSLDAHPNIGNLPIPTLNPTRQATTPFSSNSLPKGSGEFARLQSRPSGE
YKSSLKDVEMQSMVAGPRPLQKTLTSDSVQTSTSTEPETPSSGSSLRRKLSISGWRRASS
KAASHPAQTAQVRKPGPKAEEARPQQQQQQQQQQQPTKQSGMPPPRLPASATWSGAINST
PSPATSRTRPSLDFGRRKASTSAVASDTEVEKNSARKPPGNAGIRVVSGHVDASNNQPTQ
KSSSILTPMQRMLGTKSSSNMLKSRNLDSNLDRDDMLADEEMKKLASKRKDFEHAARDVD
ELRKRATAKERVSPSDAMRMANLNIFERGEIIDYKEVYFCGTKNAKKHVGDLNAQTANFG
YDDERGDYNIVLGDHLAYRYEVVDLLGKGSFGQVVRCVDHKTGGLEAIKIIRNKKRFHQQ
ALVEVNILQKLREWDPDNKHSMINFTQSFYFRGHLCISTELLGMNLYEFIKAHEFKGFSV
RLIRRFCKQMLASLVLLKAQKVIHCDLKPENILLAHPLHSEIKVIDFGSSCFETEKVYTY
IQSRFYRSPEVILGMSYGLPIDMWSLGCILAELLTGYPIFPGENEQEQLACIMEIFGPPE
KHLIEKSSRKKLFFDSLGKPRVTVSSKGRRRRPSSKTLQQALKCDDEAFLDFVARCLRWD
PERRMKPDEAMQHEFITGVRKTSQPRRPFNSSTGVSSPAKRMPAAPTSQPRVRPLPEPPA
TSFRNATAASGQREVATSNSPVKGSAPQRRHSNVQGNLVGTKRAANGAPLNTASGSGLPR
VAQRSVSGKPDLASAAAIASLKSRS
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaaccgcgaacctcaatacgagccatgacacccacaaacgtgcccgaacgg
tcagggtccaccgtctcagaagactctagtggctcttcagaagaccgagtccgcaagttc
cagaagacgggcgagcagggcaaccgactgcgcaagacgagtgcctcaaatgccataacg
gcaggtcggccgctgcccccaatcaaccacaacccggcgggacgcgggagggcaaaggtg
ccgttgggcccccgcgagccgcgacaagacttctccaagcagagaatgacgagcggcgcc
agcctcgcttccgtcgagggccgctccttcctgcccacgcccgcgaacgagacgacgacg
acgacgacgacgcgcctggctccctcgaatccacgcttcagcttctccaagcaggagcag
caacatcagcaacagcttcatcatcatcatcatcagcagcagcagcagcagcacggccag
ggtcagctcgagtcgaccaaggaagagctgagcgagagcttcggctcgtacgacttcttg
ccgtcagtcaactttgacgactttgctaatcgtctggcctatgagcctactctgagcgac
tttcccgtgcccgggaacttcacctccgacgtgcctgccggtaacggccaagtgcagatg
cagcccttcaccagcaaccccgttgacccgtacccgacacgcaccagttcctttgcccgt
cgctttagccagtcgactgtgagaaaagccagcggtggatccaccgcgtctggatccgac
acgtcttcgatgccgccgccgccttccaacatggctatccggacacgccgccagagtcaa
tttcctgcccaggcaccgccaaatccagcggcgcggccacctcgcaagagcgttggccct
ggaatgctgccaacgaatagcttcgagcgagacagggccaacgacaacaccatgccccgc
ctgacccgcgcaccttccttcagcaagggtggccgccgcgaaaccctctctgcaaacctc
agcacaactaccaccggagtacccaagctcccaaccgcaactcgaaacgccaaagcaaaa
tcgctacagcccccctcacgacatcagtcgggccacctcactgtctcgtcgaatgcccct
gatttaaatcccatgcccaacaacacccgttcgccgggtaggtcccctggcgcccagccc
tcatacggcaccccttcatcagccaacaagcgacaatcggctgcaccacacatctcaggc
ctgggtgcgagaaccatcagccccaccgacgcccgaaggctgcgaagactatccatcaac
cccaatcaccctccccccggcggccctgtcggcccccccacgccccaagccgacgccgca
tttgacgagcgtgcattcagtcagtccccggccatggtacatggaggcaacatgacaccc
tcgtcggcgcgtgcaaccccggagcagaagcgcaaatcgtatgcctcgggagtctcgctt
tcgtcaaattcaagcttgaactcgctgaaagtgggtccatcctcaatacctctacgtgtt
aatcccgcgccctcgggttcacgactacccgcaccaaagccgcgaaatgtgcaaagctcg
gccggcggggagcaggaagaagtgcctcctgtaccagccatcccaaaggcgtacgagtcc
cccaaggagccagagcgtggcagtttcacgtttaccactgccccgtcgaagatgagcacg
ccccagccggtacgtcaagacgccatggcaacaccagaggcacaaaaacccgaagccaga
cagagcgagacctcagacggcagtttctcgaacaggagctcggggtcaatcagacacagg
cgaggcttgactgtcgggaacggtccagaacaggagagaactcctacagtacaacaatct
agcaaaaagagcttgcagcccatcagactgccacccctcaatttactgccacttggcaca
ccattcaacaacaggatatcctctttcccaacaccgtctggtgatctagaagagggcgct
gtcacgccgccaccaaagcgcgctctcaacaaaacgcccagcacccccatgacagcatca
aaggcgaattttttttcacggcataccagccatgatgaataccacaaacacttacgcagc
agtagttccgcaatcaaccttcgtcaaacagactcttcgctcgacgcgcacccgaacatt
ggcaacctcccgattccaaccctgaaccccacgcgacaagccactacaccattctcatcc
aactcgttacccaaaggaagcggagagtttgctcgtttgcaatcacggcccagcggcgaa
tacaaatcttctcttaaggatgtggagatgcagagcatggtcgctggcccacggccattg
cagaagacgctcacttcggattcagtgcaaacctctacctctacagaaccagaaacaccg
tcgtctggttcgtctctgcggcgtaaactcagcataagtggctggagacgagcatcgtca
aaagcagcgtcgcacccagcgcagactgcccaagtccggaagccaggtccaaaggctgag
gaggcaagaccgcaacagcaacagcagcagcagcagcaacagcaaccaaccaaacaaagt
gggatgccaccaccacggttgccggcatctgcgacttggagcggtgccatcaattcaact
cccagtcctgctacgagtcgtacccggccatctcttgattttgggcgtcgcaaagcctcg
acatcagcagtcgcaagtgacacagaggtggaaaagaacagtgctcggaagcctcctgga
aatgcgggaatacgagttgtctcaggacacgtggatgcatctaacaatcagcccacacaa
aaatcttcctctattttgacaccgatgcagcggatgttgggcacaaagagctcatcaaac
atgctaaaatctcgcaacctagattccaatctcgatcgggacgatatgctagcagacgaa
gagatgaagaagctcgcatcgaagcgaaaggactttgagcatgcagcacgcgatgtggac
gagctccgcaaacgcgctacagccaaggaacgcgttagtccaagtgatgctatgcgcatg
gctaatctgaacatcttcgagaggggcgaaatcatcgactacaaggaggtctacttctgc
gggacaaagaatgctaagaagcacgttggtgatcttaatgcccaaacagccaactttggt
tatgacgacgagcgcggtgattacaacattgtcttgggagaccatctagcctacagatac
gaagttgttgacctcctgggcaagggtagtttcggacaggtcgtgcgttgcgttgatcac
aaaacgggagggcttgaagcgatcaagattatccgcaacaaaaagcggttccatcagcaa
gctctggtcgaagtcaacattctccagaagctacgcgaatgggaccctgataacaagcac
agcatgatcaacttcacccaaagtttctatttccgaggccacctttgcatctccaccgaa
cttcttggtatgaacttgtacgagttcatcaaagcgcacgagttcaagggcttctcagta
cgcctgatccgccgtttctgcaagcaaatgctcgcttcgctcgttcttctcaaggcccaa
aaggttattcattgcgacttgaaacctgagaacatcctactggctcaccctctacactcg
gagatcaaagtcattgactttggatccagctgctttgagacggagaaggtttacacttat
attcagtcgcgcttctatcgatccccggaagttattttgggcatgagctatggtttgccg
attgacatgtggagcttaggctgcatcctcgcggaacttcttactggctatcctatattc
cctggagagaatgagcaagaacagcttgcctgcatcatggaaatctttggtcctcctgag
aagcacttgattgagaagagtagcaggaagaagcttttcttcgactcgcttggaaagcct
agagtcaccgtttcctcaaagggccgcagacgcaggcctagctcaaagacactccagcaa
gctctgaagtgtgacgacgaggccttcctcgactttgttgcgagatgtctgcgatgggat
cctgagcggcgaatgaagcccgatgaggctatgcaacatgaattcattactggggttcgc
aaaaccagccagccacggcggccattcaatagttctacgggtgtctcgtcaccggcgaag
cgcatgcccgcagcaccaacttcacaaccccgtgttcgaccgcttcccgagcctccggcg
actagcttcagaaacgcaaccgctgccagcgggcagcgcgaagtggcgactagcaactcc
cctgtgaagggtagcgctccgcaacggcgacattccaacgtccagggaaatttggtcggc
actaagcgtgctgcgaacggggcgccgctcaatactgcaagtgggagtggcttaccgcga
gtagcacaacgcagtgtgtcgggcaagccagacctcgcttcggccgcagcgattgccagt
cttaaatcgcgttcttaa

DBGET integrated database retrieval system