KEGG   Pyrenophora teres: PTT_07784Help
Entry
PTT_07784         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pte  Pyrenophora teres
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pte00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pte00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pte00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pte00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 492 aa AA seqDB search
MDPLQAFENTSTNVAASQMRNALNKLADTVTDPAEKKYFETEMDNFFALFRRYLNDKAKG
TAIDWNRIAPPKAEQVVNYDDLANSEGVEYLNKLAVVKLNGGLGTSMGCVGPKSVIEVRD
GMSFLDLSVRQIEYLNRTYDVNVPFVLMNSFNTDTDTASIIKKYEGHNIDILTFNQSRYP
RILKDSLLPAPKENKSDIANWYPPGHGDVFESLYNTGMIDKLMERGIEYIFLSNADNLGA
VVDLRILQHMVDSKAEYIMELTDKTKADVKGGTIIDYEGSVRLLEIAQVPKEHVNEFKSI
KKFKYFNTNNIWMNLAAIKRVVEANELAMEIIPNGKSIPADKKGEADISVLQLETAVGAA
IKHFKNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTLQHGQLVIDPNRFGPAPLIKLGSDF
KKVSSFQARIPSIPKIVELDHLTITGPVNLGRGVTLKGTVIIVATEGSTIDIPPGSILEN
VVVQGSLRLLEH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaccctctccaggctttcgagaacacatcaaccaacgtcgctgcttcgcaaatgcgc
aatgctcttaacaagctcgccgacaccgtcaccgaccccgccgagaagaagtacttcgag
acggaaatggacaacttcttcgccctcttccgccgatacctcaacgacaaggccaagggc
actgccattgactggaatcgcattgctccccccaaggctgagcaggtcgtcaactacgat
gacttggccaactccgagggcgtcgaatacctgaacaagttggcagttgtcaagctcaat
ggtggtctcggtacctcgatgggttgcgttggcccaaagtcggtcattgaggtccgtgat
ggtatgtccttcttggacctgtcagtacgacagatcgagtacctgaaccgcacatacgac
gtcaacgtaccgtttgtgttgatgaactcgttcaacaccgacaccgacacggcgagcatc
atcaagaagtacgagggccacaacattgacatcctcaccttcaaccagtcgaggtaccct
cgtatcctcaaggactcgctcctgcccgcacccaaggagaacaagtcagacattgccaac
tggtacccccccggtcacggtgacgttttcgagtctctttacaacacgggtatgattgac
aagctcatggagcgcggcattgagtacattttcctctccaacgccgacaacttgggtgcc
gtcgtcgatctccgaatccttcagcacatggtcgactccaaggctgagtacatcatggag
ttgacggacaagacaaaggccgacgtcaagggtggtaccatcatcgattacgagggctcc
gtccgcctgcttgaaatcgctcaggtgcccaaggagcacgtcaacgagttcaagtcgatc
aagaagttcaagtacttcaacaccaacaacatctggatgaacctggcggccatcaagcgt
gttgtcgaggccaacgagcttgccatggagatcatccccaacggcaagtcgatccctgcc
gacaagaaaggcgaggccgacatctcggttctccagctcgagacggctgtcggtgctgcc
atcaagcacttcaagaacgcacacggtgtcaacgttcctaggcggcgattcttgccggtc
aagacttgctcggacctcatgcttgtcaagtctgatctctacactctgcaacacggccag
ctagtgatcgaccctaaccgattcggccctgcgccgttgatcaagctcggcagcgacttt
aagaaggtttcgagcttccaggcccgcatcccttcgatccccaagattgtcgagctcgac
catcttaccatcacgggcccggtcaacctcggtcgtggcgtcaccctaaagggtaccgtc
atcatcgttgcgaccgagggctccacgatcgacattcccccgggttccatcctggagaac
gtggtggtgcagggttcgctcaggctgcttgagcactag

DBGET integrated database retrieval system