KEGG   Pyrenophora teres: PTT_08015Help
Entry
PTT_08015         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
pte  Pyrenophora teres
Pathway
pte03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PTT_08015
Ribosome biogenesis [BR:pte03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    PTT_08015
Translation factors [BR:pte03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PTT_08015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit Phage_GPD PRP4
Motif
Other DBs
NCBI-ProteinID: EFQ94340
UniProt: E3RIW4
Position
Unknown
AA seq 270 aa AA seqDB search
MAPGKWDDEEEGSTPATSPTIAPISRRSKFDDEEEDDDVLESWDAAEDSEVEREKAKKAA
EAKAKAEAEAKANHKSKAQRIEEHRQAALRRRQMEDDGETDEEETEAERRARLRQQEVDG
SRAQAEELFGDLSVSNKRAGKAVTITDESDPGKAIDLSSLAIFNPNTKDQFTKLRETLTP
LLVANSKKGQYSLFLQEFTKQIAKELPSEQIKKIASGLTTLSNEKMKEEKAAEKGGKKSK
AAKTKTTLNASRDVGVRADTRAYDDEDFGE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctcctggaaagtgggacgatgaagaagagggcagcacgcctgctacctctccaacg
atagcgcccatctcgcgccgcagcaaattcgacgacgaggaagaagatgacgatgtgcta
gagtcatgggacgcggccgaagactctgaagtagaacgcgaaaaggcgaagaaggcggcc
gaggccaaggcgaaagcagaggccgaggcaaaggcaaaccacaagtcaaaggcgcaacgg
atcgaggagcacagacaggctgctctccgccggcggcagatggaagacgacggcgagacg
gacgaagaggagaccgaggccgaacgtcgtgcacgccttcgccagcaggaagtcgacggc
tcgcgcgcccaagccgaagaactctttggcgacctcagcgtcagcaacaagcgcgcaggc
aaggccgtcaccatcaccgacgagagcgacccgggcaaggccatcgacctctcgtcgctc
gcaatcttcaacccaaacaccaaagaccagttcaccaagctgcgcgaaacactcacacct
ctgctcgtggcaaactccaagaaggggcaatactcgctgttcttgcaggagtttacaaag
cagattgcaaaggagctgccgagtgagcagattaagaagattgcctctggcttgacgacg
ctgagcaatgagaagatgaaggaggagaaggcggcggaaaagggcggcaagaagtcaaag
gcggcaaagaccaagacgacgcttaatgcgagtagggacgtgggtgttcgtgcggatact
agagcatatgacgatgaggactttggcgagtaa

DBGET integrated database retrieval system