KEGG   Pyrenophora teres: PTT_08015Help
Entry
PTT_08015         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pte  Pyrenophora teres
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pte03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 270 aa AA seqDB search
MAPGKWDDEEEGSTPATSPTIAPISRRSKFDDEEEDDDVLESWDAAEDSEVEREKAKKAA
EAKAKAEAEAKANHKSKAQRIEEHRQAALRRRQMEDDGETDEEETEAERRARLRQQEVDG
SRAQAEELFGDLSVSNKRAGKAVTITDESDPGKAIDLSSLAIFNPNTKDQFTKLRETLTP
LLVANSKKGQYSLFLQEFTKQIAKELPSEQIKKIASGLTTLSNEKMKEEKAAEKGGKKSK
AAKTKTTLNASRDVGVRADTRAYDDEDFGE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctcctggaaagtgggacgatgaagaagagggcagcacgcctgctacctctccaacg
atagcgcccatctcgcgccgcagcaaattcgacgacgaggaagaagatgacgatgtgcta
gagtcatgggacgcggccgaagactctgaagtagaacgcgaaaaggcgaagaaggcggcc
gaggccaaggcgaaagcagaggccgaggcaaaggcaaaccacaagtcaaaggcgcaacgg
atcgaggagcacagacaggctgctctccgccggcggcagatggaagacgacggcgagacg
gacgaagaggagaccgaggccgaacgtcgtgcacgccttcgccagcaggaagtcgacggc
tcgcgcgcccaagccgaagaactctttggcgacctcagcgtcagcaacaagcgcgcaggc
aaggccgtcaccatcaccgacgagagcgacccgggcaaggccatcgacctctcgtcgctc
gcaatcttcaacccaaacaccaaagaccagttcaccaagctgcgcgaaacactcacacct
ctgctcgtggcaaactccaagaaggggcaatactcgctgttcttgcaggagtttacaaag
cagattgcaaaggagctgccgagtgagcagattaagaagattgcctctggcttgacgacg
ctgagcaatgagaagatgaaggaggagaaggcggcggaaaagggcggcaagaagtcaaag
gcggcaaagaccaagacgacgcttaatgcgagtagggacgtgggtgttcgtgcggatact
agagcatatgacgatgaggactttggcgagtaa

DBGET integrated database retrieval system