KEGG   Pyrenophora teres: PTT_08066Help
Entry
PTT_08066         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PTT_08066
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PTT_08066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 168 aa AA seqDB search
MSGGWNTIESDAGVFTYLIEKLGVKDVQFEELTTLDAADLQALGTLYGVIFLFKYPTGEK
PSDVPKDGTYDYEAANTLFFPAQTIQNACGTQAIVSLLLNREEEVDIGKELKEFKEFAGD
FPPELRGETLSNSDLIRETHNSFARSSPFVDETQRTATEDDDVFHFIA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggggctggaacaccatcgagtccgatgcaggcgtcttcacctacctcatcgag
aaactcggcgtaaaagacgtacagtttgaagagctcaccacgctcgacgcggcagaccta
caagccctgggaacactctacggggtcatcttcctgttcaagtacccgacgggcgagaaa
ccgagcgatgtacccaaggatggaacatacgactacgaggcggcgaataccctctttttc
ccggcgcagacgatacagaatgcatgtggtacacaggccattgtgtcgctgttgttgaac
agggaggaggaggtggatattggcaaggagctgaaagagttcaaggaatttgcgggggat
ttccctccagagctgcgtggagaaacactttcaaactccgatctcatccgcgaaacacac
aactcgtttgcgcgctcctcgccctttgtcgacgagacgcagcgtaccgcaaccgaagac
gacgatgtattccactttatcgcgtaa

DBGET integrated database retrieval system