KEGG   Pyrenophora teres: PTT_08066Help
Entry
PTT_08066         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 168 aa AA seqDB search
MSGGWNTIESDAGVFTYLIEKLGVKDVQFEELTTLDAADLQALGTLYGVIFLFKYPTGEK
PSDVPKDGTYDYEAANTLFFPAQTIQNACGTQAIVSLLLNREEEVDIGKELKEFKEFAGD
FPPELRGETLSNSDLIRETHNSFARSSPFVDETQRTATEDDDVFHFIA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggggctggaacaccatcgagtccgatgcaggcgtcttcacctacctcatcgag
aaactcggcgtaaaagacgtacagtttgaagagctcaccacgctcgacgcggcagaccta
caagccctgggaacactctacggggtcatcttcctgttcaagtacccgacgggcgagaaa
ccgagcgatgtacccaaggatggaacatacgactacgaggcggcgaataccctctttttc
ccggcgcagacgatacagaatgcatgtggtacacaggccattgtgtcgctgttgttgaac
agggaggaggaggtggatattggcaaggagctgaaagagttcaaggaatttgcgggggat
ttccctccagagctgcgtggagaaacactttcaaactccgatctcatccgcgaaacacac
aactcgtttgcgcgctcctcgccctttgtcgacgagacgcagcgtaccgcaaccgaagac
gacgatgtattccactttatcgcgtaa

DBGET integrated database retrieval system