KEGG   Pyrenophora teres: PTT_08453Help
Entry
PTT_08453         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pte  Pyrenophora teres
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pte00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 280 aa AA seqDB search
MDLLPVALAFAAIVGGFLFFRSSSAGSRKVLKPTEFQEFELEHKEVLSHNTAIYRFKLPR
PTDILGLPIGQHISLAATIAGQPKEVVRSYTPITSDEDKGHVDLLIKSYPTGNISKHVAN
LRIGDKMKVKGPKGAMVYTPNMVRHFGMIAGGTGITPMLQVAKAIMRGRASGDRTEVDLI
FANVNPEDILLKDDLDSLAAKDPKFRVHYVLNNPPEGWTGGVGFVSADMIKEKLPAPAND
IKILICGPPPMVAAMKKATESLGYTKARPVSKLEDQVFCF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggatctactgccggtcgcactggcctttgcagccattgtaggcggcttccttttcttc
cgcagcagcagcgctggatcccggaaggtgctcaaacccaccgagttccaagagttcgaa
ctcgagcacaaggaggtgctttcacacaacacagccatctaccgcttcaagcttccgcgc
ccgaccgacatccttggtctccccatcggccagcacatctccctcgctgctaccattgcc
ggccagcccaaggaagtcgtacgatcatacacgcctatcacatcggatgaagacaagggt
cacgtcgacctgctcatcaagtcataccccacgggcaacatctccaagcatgttgcaaat
ctgcgcatcggcgataagatgaaggtcaaggggcccaagggcgccatggtatacacaccc
aacatggtcagacactttggtatgattgctggtggtactggcatcacacccatgctacaa
gttgcaaaggccattatgcgtggccgcgcgtccggtgaccgcaccgaagtcgacctcatc
tttgcaaacgtaaacccggaagacatcctgctcaaggacgacctcgactcgctggctgcc
aaagaccccaagtttagggtacactacgtgctgaacaacccgcctgagggatggaccggt
ggagtcggcttcgtgtcggctgatatgatcaaggagaagcttccggctcctgcaaacgac
attaagatcctcatctgtggtcccccacccatggttgccgccatgaagaaggcaacggag
agcctcggatacacaaaggccaggcctgttagcaagcttgaagaccaagtcttctgcttc
taa

DBGET integrated database retrieval system