KEGG   Pyrenophora teres: PTT_08454Help
Entry
PTT_08454         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pte  Pyrenophora teres
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PTT_08454
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PTT_08454
   04113 Meiosis - yeast
    PTT_08454
Protein phosphatases and associated proteins [BR:pte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PTT_08454
Ubiquitin system [BR:pte04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     PTT_08454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 768 aa AA seqDB search
MSPPPGVNAQLRQLVHYHLDNGFTENALFLAGRLHALEPRSTDASHLLALCSLRLGRYKA
AYDEARAKGAHVQHLGCAYVFAQACLALGRHEQGAHALEKVRSLWAGRNHWNKHSDTSRR
HMPDAAACYCMLGKLYAAHGDTKKAIDHFVDALKINSFMWDAFTSLCDIGAVVRPHNIFK
ITPDMLPLPSPSEVDPFNPSSRQAGDGRLNMGGANLLSRFNSGRSTQSTHHQDVETPVSN
GHSMHNMHDMHATMGDAGGLGAIRPVTGRVRTKTNPEIDQTDIPRPIYQNGHKRTVSGHA
LQPSQNPSSQPIDPTAAPPRRSVRLLNSVTQIRTTSSRPGGSSNRDVESKERRELRRARA
AVPKTRSGTTTSTVGRVVSGNRKPHVEVSDLPPKTEGRPASVTGMPVAPPPKMAPPADSS
RERDRDRERDVLNWLLDLLLKIASGYRHLSRYDAIKALEAFAAVPKAQRETPWVLGHIGK
AQYECSQYAEAGSTFKKIRDLAPSSVEHMEVYSNTLWQLKDELALGHLAHTLMDQDRLSP
QAWCALGNASSLSRQHDDAVKCFSRATQLDPKFAYAFTLQGHEHVANEEFDKAMAAYRNA
ISADNRHYNGWYGLGNVYERLGKYEVAEKHYRAAADINQSNAMILVRIGLVLDRMKKIEP
ALMQFENAIRIDPRSIMARFRKSQVLLKLNAPQEALHELLYLKDAAPDDPNIHFLLGRCY
KKLRERASAIRHLTIAMNLDPKSHGVIKEVMESLDQEDDGGWSSEDDH
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgccaccgggcgtcaatgcccaactgcgccagctcgttcactaccacctcgac
aacggcttcaccgaaaacgctctcttcctcgcgggccgcctgcacgctctcgagccccgt
agtacggacgcatcgcatctacttgcgctctgtagtctccgcctgggtagatacaaagct
gcctatgacgaggcgcgggccaagggagcccatgttcagcatcttggatgcgcctacgtc
tttgctcaggcatgtctcgccctcggccgtcatgagcagggtgcgcatgcgctggagaag
gtgcgtagcctatgggccggacgaaaccactggaacaagcactcggacacttcacgacgg
catatgccggacgcggccgcctgctactgtatgctcggcaagctatatgctgcacacggc
gacaccaaaaaggctattgaccactttgtcgacgcgctcaagatcaactccttcatgtgg
gacgccttcactagcttgtgtgacattggcgccgtagtccgcccccataacatcttcaaa
atcacccccgatatgctccctctaccttcgccatcggaagttgaccctttcaatccctcg
tcacgacaagctggggatggccgactcaacatgggcggcgcaaacctgctttccagattc
aatagtggccgcagcacccaatccactcaccaccaagacgtcgaaaccccagtatccaac
ggccatagcatgcacaatatgcacgacatgcatgctaccatgggcgacgctggcggacta
ggtgccatccgccccgtaactggacgagtacgaaccaagacgaacccggaaattgaccag
accgacattccacgcccaatataccagaatggacataagaggaccgtgtctggccatgcc
ctgcagccttcacagaacccatcttcacagccgatagatcccactgcagcgcccccgcgc
cgaagcgtccgattactgaactcggtaactcagatacggaccacaagcagtaggccaggg
gggtcttcgaacagagatgttgagtcaaaggagcgacgcgaactgcggagagcgagggct
gcagtacccaagacacgatcagggaccacaacctcgactgtaggaagagttgtcagtggc
aacagaaagccgcacgttgaagtctctgatctaccacccaagaccgagggaaggcctgcc
agcgtgacgggcatgcctgtcgcgccacccccaaagatggcgccaccagccgactcgtca
agggagcgagaccgggaccgggagcgggatgtattgaactggctgttagatttgcttctc
aagatcgcatccggttatcgccatctgagtcgctacgacgcaatcaaggcactcgaagct
tttgcagctgtaccgaaagcccaacgggaaacaccctgggtccttggacacattggcaaa
gcccagtacgagtgtagtcaatacgcagaggcggggagcacgtttaagaagatccgagac
ttggcgccatcttccgtagagcacatggaagtttattcgaacacgctctggcagctcaaa
gatgagctggctctaggtcatcttgcccacacactgatggaccaagatcgactctctcca
caagcttggtgtgccctcggcaacgctagttcgctgtctcggcagcatgacgatgctgtg
aaatgcttttcccgcgctacgcagctagaccctaagttcgcatatgcttttactttacag
ggtcacgagcacgtggctaacgaagaattcgacaaggccatggcggcgtaccgcaatgct
atcagcgccgacaacagacactacaatggatggtatgggcttggtaatgtgtatgagcgt
ctaggcaagtacgaggtggccgagaagcactaccgagcagcggcagacatcaatcagagc
aacgcaatgattcttgtccggattggtctggtcctcgaccgcatgaagaaaatcgagccc
gcacttatgcaattcgaaaacgcaattcgcatcgaccctcgctcaattatggcccgcttc
cgcaaatcacaagtcctactcaaactcaacgcgccgcaggaagcactccacgaacttctc
tatctcaaagacgctgctccagatgacccgaacatccacttcttactcggacgctgctac
aagaagcttagggaacgcgctagcgctatccgccatcttacaatcgctatgaatttggat
cccaaaagccatggtgtcatcaaagaggtcatggagagtctggatcaagaagacgatggt
gggtggagtagtgaggatgatcattga

DBGET integrated database retrieval system