KEGG   Pyrenophora teres: PTT_08509Help
Entry
PTT_08509         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pte  Pyrenophora teres
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PTT_08509
  Lipid metabolism
   00062 Fatty acid elongation
    PTT_08509
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     PTT_08509
Lipid biosynthesis proteins [BR:pte01004]
 Fatty acid synthase
  Component type
   PTT_08509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 327 aa AA seqDB search
MLHLLPLSTVLLVTQALAATTAGTESKPLPLLIWHGLGDNYQADGLHSVGELANETNPGT
YVYYIHIDEDAGSDRTATFLGNVTEQIAKVCDDIAEHEVLSKAPGLNALGFSQGGQFLRG
MIERCGERVKVKNLVTFGSQHNGIAKYQICKDGDWLCKGYISLLKANTWGSWVQGHLVPA
QYFKATNETTGEPTDEYLESSNFLADVNNERVLKNVTYAKNLAALDNFVMYVFEDDTTVI
PKESGWFAYTNTTSNDVTDLRDRDIYKEDWIGLKKLDQKGGLHFKTTKGGHMDLGEKVLK
DVFETYFSLAESAWEGVVKKAQEAIEL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatctactaccgctctcgactgtgcttcttgtgactcaagcactagccgcgact
accgccggcactgaatccaagcctcttcctctgctcatctggcatggcctaggcgacaac
taccaggccgacggtctccacagcgtcggcgaactcgcaaacgagacaaatcccggaacc
tatgtatactacatccatattgatgaagacgctgggagtgaccgaacggcgacgttctta
ggcaatgtcacagagcagattgcaaaggtctgcgacgacatcgcagagcatgaagtcctg
tccaaagcaccaggcctgaacgccctgggtttctcacaaggcgggcagttcctgcgcgga
atgatcgaacgctgcggagagcgagtgaaagtcaagaacctagtgacatttggcagccag
cacaacggcatcgcgaaataccaaatctgcaaggacggtgactggctatgcaaaggctac
attagtttgctaaaagccaatacttggggctcatgggtccaaggccatctcgttccagcc
cagtacttcaaggcaactaacgaaacaacgggcgagcctacggacgaatacctcgaatcc
tcaaactttctcgccgacgtcaacaacgagcgtgtactgaagaatgtcacctatgcgaag
aatctcgctgcactcgacaacttcgtcatgtacgtgttcgaggacgacacgacggtcata
cccaaggaaagcggatggttcgcatacacaaacactacttcaaatgacgtcacggacctg
agagatcgcgatatctacaaagaggactggattgggcttaagaagttggatcagaagggc
ggtctgcacttcaagactacaaagggcgggcatatggacttgggcgagaaggtactaaag
gatgtattcgagacctacttttcgcttgccgagtcagcttgggaaggcgttgtaaagaag
gcgcaggaagccattgaattgtag

DBGET integrated database retrieval system