KEGG   Pyrenophora teres: PTT_08592Help
Entry
PTT_08592         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pte  Pyrenophora teres
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pte03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1619 aa AA seqDB search
MVEDDSLAALQGLHRDLCAHIDLQLPVLERLLQNLEVHLDELKTLLDKKPKNDSSRQTLS
SGKIKIDDNEYEVNDDFKQQTLELADALDLDELDAAALFLGAQSEAKELDRSQLQTAVIR
FHRRREYVLLCVRILMKTALDSEDAEVEGLPILQEATQMIVGVHGTTNLAGAYGFWTKCL
TSMESVERWLHFIAERVQSTQVVGQVPLPGFVEIMEFQRQSLTRQHENLAAICTHLVKPG
YVNLDNFKALLARAKTLDRHDLITIHYVPILLRLMSWVASETNNDAALQNINFEDEANAR
SDIFLKTLNDGAFHFILSVSQDVRPTRWYDPQKTSMLSTLLQDTAVLSRESTQPDDFFKL
LLMEQLQTFVDSFITNMPDTLRKLKAEEDDQRRRLQFQFQRSTGEYPLHLERFMVIVAYA
FDGFPDAAEDFWSDKESNLYGFLQWAAKRQPTPRIAMFCEMLRAIGTGETNAEAAHRFLL
EEGASASGKIRRTSSLSYTTIFNELCEFERDIHEPKKTVQGGVYAPTTNPIDQIVEPESA
TMLESYLRLLAHICRQSVLARRWILELKEYDLASICFGLCTDKVESGLRAAAYDALSAMM
VGKDSERGNTMWQILDDWTVNGFYTGAKQNNALSTAPRDDFWPTLADGYDESIAFVRFLH
SLVEPYPENEGLNDSLPFPETLGSSRRMPGAEGYIDFVMQQVFAERSMDVLDPLQRNVMR
WTCLRFIVTCLSTFNENLVVFANKSSIPVDDVIDAPSLVVYVALHPFARVMEWLFNDKVL
KALFAAAHHDAAEVDAAPSDSPLIQSLMLSIEVMDLVMKLQATYLDIVRPVLKQQTSFHH
SLVSNLSLASFEDAILNNLHIIVDLGLYCGTGHEALTIASLQLLEKMASSRKLAVSPAGF
GQRSGRSKIVGILEKDNEAERIGRSLSGLMRFNAEELEAGEEASGYIVKLRILDFLSSCL
AAVSLRPTIAHILLGFSCGSNAVRIADGSLWSNGQSLFHNILLLGVEYPDNDGEQFLAWR
SALKTRCWDVLQKLWRSPLTSAIVMEELRDNELLFIEAPQLTPITHDIPWEGMSLAQGLD
VAPSQYSAFFSGPPALALQNFLQRRAALLDYESRELRLTVKENMPTMKSRIQSVLLGTTI
RPGENATSNPNIFDLFDFIELVYPERALPDQHMFFEGVNLTSCQEDKDGMTLYSLPLLEQ
LIRLKIKSWTKGENTNEKLDQLAALAEQADLLMAIFVDWNRRTQLQRYHKDILQSWVQVV
MVAVHNCDFEKGAQSSFILQTLQVILPKLEQSYASDIFTALQLAGLAESLIQKVDFESTA
FDKTGDFANDRLSQLFRAALVGIHSPVSTTELREYCYQICFRYINGTFHKATPNSLLGRH
TLGAIRNCGSHMLEVICDDAYSGQGTCKVSALLLLNAFVAVATRQSSKYILESFVSLNFV
GVLVDNIKHIPEELCAAAAPQVPVLFSYYDASLALLLRTCQSRLGAAYVLNAGLFPAIRD
SQIFAVDPDIGLEFDDANALRKYYGLMLSVLRVINGAVIARGRQNDQTVFQAREFLKDNR
HSMVSIFKRSVNVGVGMGEEIQQDIVDLVDCWTILVDITGFLEYEDQPSIKKARPNMFS
NT seq 4860 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagacgacagcctcgccgccctccagggcctgcaccgcgacctatgcgcccac
atcgacctgcagttaccagtattagagcgactgctgcagaacctagaggtccacctggac
gagttgaagacgcttttggacaagaagccaaagaatgattctagcagacagacgctgagt
tctggcaagatcaagatcgacgacaatgaatacgaggtcaatgacgacttcaagcagcag
acgctcgaactcgccgatgccctggatctcgatgaattagacgccgccgcccttttcctg
ggcgcccaaagcgaagccaaggagctcgaccggtcccagctgcagacggctgtgatccgc
ttccaccgacgccgcgaatatgtcctactctgtgtgcgcatcttgatgaagactgccctg
gacagcgaggatgctgaggtcgagggactccccatcctccaggaggctacccagatgata
gtcggtgtacatggcacaaccaacttggcgggcgcatatggcttttggacaaagtgcctg
accagcatggagtcggtagagagatggctgcacttcatcgctgagcgcgttcagagcacc
caggtggttggccaggtgcctcttccgggctttgtggagattatggagtttcagcgccag
agcctgacccgacagcatgagaatctcgctgcgatatgcacacacctggtcaagcctggc
tacgtcaacctcgacaacttcaaggcgttgctggcccgggccaagaccctcgatcgacac
gacctcattaccatccactatgttccgatcctgcttcgactcatgtcctgggtcgcctcg
gagaccaacaacgacgctgctctgcaaaacatcaacttcgaagatgaagccaacgcccga
tccgacatcttcctcaaaacactcaacgacggcgcctttcacttcatcctatccgtcagc
caggatgtgcgcccgacacgctggtacgatccgcaaaagaccagcatgctttcgacgcta
ttacaagacactgccgtcctaagccgcgaatcaacccagcccgacgacttcttcaagctg
cttctcatggagcagctgcagacttttgtggactctttcattacaaacatgccggatacc
ttgcgtaaactaaaggccgaggaggacgaccagcgacgacgactccagttccaattccaa
cgatcgaccggagagtatccactccatctcgaacgtttcatggttatcgtggcatacgct
ttcgacggtttccctgatgcggccgaagacttttggagcgacaaggagagcaatctgtac
ggtttcctgcagtgggctgccaagcgtcaacccactccccggatagccatgttctgcgaa
atgttacgggccattggcaccggagagacgaacgcggaggctgcgcaccgcttcctgctc
gaagagggagcatccgcgtctggaaagatccgtcggacgagctctttgagttacacaacc
atctttaacgagctgtgcgagtttgaaagagatattcatgagccgaagaagacagttcaa
ggcggtgtctatgcaccgacgaccaacccgatagatcaaatcgtagagccagagagtgca
accatgctggaaagttacttgcgacttcttgcacacatctgccgacaaagtgtcctcgca
cgcaggtggatattggagctgaaggaatatgacttggccagtatctgcttcggattatgt
accgacaaagttgaaagtggactgcgcgcagcggcttatgacgcgctatcagccatgatg
gtcggtaaagactctgagcgaggtaatactatgtggcagattctagacgattggaccgtc
aatggcttctacactggagccaagcaaaacaacgccttaagcactgcgccgagggacgac
ttctggcccacgctggcagatggctatgacgaatccatcgcgttcgtccgctttctccac
tcgcttgtggagccttaccctgagaacgaagggctcaacgacagtttaccgtttcccgaa
actcttggctcctcgcgcaggatgcctggcgccgagggctacattgattttgttatgcag
caagtattcgctgaacgttctatggatgtgcttgacccgttgcaacgcaacgtcatgcgc
tggacctgcttgcgttttatagtaacgtgcctgtcgaccttcaacgagaatctcgtcgtc
ttcgccaacaagtctagcataccggttgatgatgtcatcgacgccccgtctctcgttgtt
tatgtcgcgctccatccattcgcacgcgtcatggaatggctctttaatgacaaggttcta
aaagctttgtttgctgccgcacatcacgatgcggccgaagttgacgctgctccatcggac
tcccccttgatacaatcactgatgctgagcattgaagtgatggatttggtaatgaagcta
caagcgacatatctggacatcgtcaggcctgtactcaagcaacaaacgtcgttccatcat
tctctagtgtccaatctgtcactcgcctccttcgaagatgcgattctgaacaacctgcat
attatcgtcgaccttgggttgtactgtggtaccggacatgaggctctaaccattgcctca
ctacagctactagagaagatggcctcctcacgaaagcttgctgtatcaccggccggtttc
ggacagcggtcagggcggagcaagattgttggtatactggagaaggacaatgaagcagag
cgtatcggccgatcactttcgggattgatgcgtttcaatgccgaagagcttgaagctggc
gaggaagcttctggatacattgtcaaactccgcattttggactttttgagtagttgtctt
gctgccgtctcgctccgcccaacgatagcgcacattcttttggggttttcatgtggatct
aacgctgtccgcattgccgacggcagtctttggtcaaacggacaatccttgttccataac
atactcctccttggtgtggagtaccctgacaacgatggcgaacaattcctagcatggcga
tcagcactcaagaccagatgttgggatgtactccagaagctgtggcgctcaccattaaca
agtgcgattgtcatggaagagctccgcgacaacgaattgctgttcattgaagcaccccaa
ctgacaccgattactcatgacataccatgggaaggaatgtctttggcacaaggactggat
gtcgcccctagccaatactctgcattcttctctggccctccagcgctggctcttcaaaac
ttcctccaacgccgtgctgcgttactagactatgagtcaagagagttacgcttgactgtg
aaagagaacatgcctacgatgaagtctaggatccaatcagtactccttggtaccactata
cggcctggagagaacgcaacatcaaatccaaacatattcgacttgttcgactttatcgag
ctagtctacccagaacgtgcgctgccagatcaacacatgtttttcgaaggcgtcaacctt
acatcatgtcaggaggacaaggatggcatgacgctttactctttgccactactggagcaa
ctgattcgtttaaaaatcaagtcctggacgaaaggggaaaacacaaacgagaaactcgat
caactcgctgctcttgcggaacaggcggatctcttgatggctattttcgtagactggaat
cgtcgcactcaacttcaacgctatcacaaggacattcttcaatcatgggtacaggttgtc
atggtggcggtacacaactgcgatttcgaaaaaggggcgcagagttccttcatcttgcag
accttgcaggtcattctcccgaagctcgagcagtcttacgcatcggatattttcactgct
ttacagcttgctggccttgctgaatctcttattcaaaaggtggactttgaatcaacggcg
tttgacaagaccggagattttgccaacgatcggctgtcccagctgttccgtgctgcactc
gtgggaattcacagcccagtctctactaccgagctccgggaatactgctaccaaatctgc
ttccgctatatcaacggtaccttccacaaagcgacacccaactctttgctcggtcgacat
acgcttggcgctatcaggaactgcggtagccacatgcttgaagtcatctgtgatgatgct
tacagcggacagggaacatgcaaagtttccgctctgctcttgctgaatgcatttgtagca
gtggcgacgcgccaatcgtccaaatacatccttgagagcttcgtctccctcaactttgtt
ggcgtcctcgtcgacaacatcaagcatattcccgaagagctctgtgctgccgctgctccg
caggtccccgttctcttctcatactacgatgccagcctcgcactactcctgcgcacatgc
cagtctcgcctcggtgccgcatatgtgctcaatgcaggtctttttccagctatccgcgat
tcgcagatcttcgcagtggatcccgatattggtctagaatttgacgatgcgaatgcacta
agaaaatactacgggcttatgctctctgtcctacgagtcatcaacggagctgtaatcgcg
agaggtcgacaaaacgaccagacagtcttccaggcgcgtgaattcttgaaggacaataga
cacagtatggtgagcattttcaagagaagtgttaatgtaggtgtgggtatgggtgaggag
atacaacaagatattgttgatttggttgattgctggacgatattggtggacattaccggg
ttcttagagtacgaggatcagccgagtataaagaaggcaaggccgaatatgttttcttaa

DBGET integrated database retrieval system