KEGG   Pyrenophora teres: PTT_08649Help
Entry
PTT_08649         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pte  Pyrenophora teres
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PTT_08649
  Amino acid metabolism
   00380 Tryptophan metabolism
    PTT_08649
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PTT_08649
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PTT_08649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1074 aa AA seqDB search
MASATEPIPGPPGLPLLGNLKDIDPTVPILSFCNLTLQYGPIWKFTLGVGGERVMIANQA
LMDEVCDEERFRKNVVGALVEVRNGVHDGLFTAHAEEENWGIAHRVLLPALGPLAIRGMF
DDMHDISSQLVMKWARYGAGHQINVADDFTRLTLDTIALCAMDYRFNSYYTNEMHPFIDA
MVDFLKTSGDRARRDPIMQMFYGAETQKYWRDIDLLRKTSLDVVETRKKNPTDKKDLLNG
MLKGVDPKTGKKMPEESVMDNMITFLIAGHETTSGLLSFAFYYLLRNPEVYQKAQQEVDN
VIGKGSVTVDHLSRVPYLTAVLRETLRLQPTAPAINLTAKEDTTIGGKYAVKAGQPIICL
FPMIHRDPAVYGEDAEEFRPERMLDDEFERRNKEFPNCWKPFGNGMRACIGRAFAWQEAL
LVLALLLQNLNFSMDDPSYQLQIKQALTIKPKDFYMRATLRNGISATGLKTSLASATANR
PDSAKSTSDTVKVSDGETAKGKPIAIYYGSNTGTCEALANRLASDAAQHGFTAEVVDTLD
TVRGNLPTDKPVVIVTPSYEGAPADNAAHFVSWLGTLKEKELENVSYAVFGCGHRDWAKT
YQKIPKYIDATLEERAATRLADMGVADAAEGDIFTAFETWEDQILWPALRAKYGSEQATG
EGSLETNLDVEISAPRSSTLRQDVYEAVVENVQVLSTSDVSEKRHIEISLPSSMSYTAGD
YLAILPLNPKQNIQRAMRYFGLTWDSMLTISTNGPTTLPTDIPISANTVLGAYVELAQPA
SKRNVQALVDTTTDESEKKELIRLADEAFSSEITAKRVSILDLLEQFPSTKLPLGVFLKM
LPPMRVRQYSISSSPIWNPSNVTLTYSVVNDVALSGRGRHVGVATNYLANLTAGDRLHVS
VRQSHKAFHLPKDPEKIPIIMIAAGTGLAPFRGFIQERAAQVAAGRNLAPAILFYGCRTP
TTDLIYADLLKRWEDMGAVSIRYAFSRQSEDSHGCKYVQDRVYHDRADVIKLFDAGAKLF
VCGSRNVGNGVQETLIRVAKERHFEKEGVEADDAKARAWFDELRNERFATDVFE
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgctaccgagccaatacctggccctcccggcctacctctcctgggcaatctc
aaagacattgatccgactgtcccaatattatctttctgcaacctaacgttgcaatatggc
ccaatatggaaattcactcttggcgtcggcggcgaacgtgtcatgattgccaaccaggca
ctcatggacgaagtttgtgacgaggaacgattcagaaagaacgttgtgggtgcactcgtc
gaggtgcgcaacggtgtacacgatggtctcttcaccgcacatgccgaagaagagaactgg
ggcatcgcacatcgtgtactgttaccagcgctcgggccgcttgctattcgcggcatgttc
gacgatatgcacgatatttcttctcagcttgtcatgaaatgggcgagatatggagcgggg
caccagatcaacgtcgccgacgacttcacacgtctgactctcgacaccatcgcgctatgt
gctatggactaccgtttcaactcgtattacacaaacgagatgcatccattcattgacgca
atggtggattttctcaagaccagcggggaccgagcaaggagagacccaatcatgcagatg
ttctatggcgccgagacccagaagtactggagagatattgatttgctacgcaaaactagt
cttgacgtcgtcgagacgaggaagaagaaccctacagacaagaaagacctgctcaatggc
atgttgaaaggtgtcgatccgaaaacggggaagaagatgcctgaagaaagcgtcatggac
aacatgattacattcttgattgctgggcatgagacaacatccggcttactgtcattcgca
ttctactatctgctaagaaatccagaagtataccaaaaagcacagcaagaggtcgacaat
gtgattggcaaaggttcagtcactgttgatcacttatcacgtgtcccttacttgacagct
gtgcttcgagaaactcttcgcctccagccaacggccccagcgatcaatctgaccgcaaag
gaagacactaccattggcggtaaatatgccgttaaagctgggcagccaatcatctgtctc
tttcccatgattcacagagatcctgccgtatatggagaagatgctgaagagttccgtcca
gagagaatgctcgatgacgagtttgagcgacgtaacaaggagttccccaactgttggaag
ccctttggaaacggcatgcgcgcatgtatcggaagagcctttgcctggcaagaagctctc
ctggtgcttgccctgctcctccagaacttgaacttctcaatggacgacccttcataccaa
ctccagatcaagcaggctttgaccatcaagcccaaggatttctacatgcgcgcaaccctt
cgcaatggcatctcagctacaggcctcaaaacatctttagcatcagccactgccaaccgg
ccagactcagctaagagcactagtgacaccgttaaagtctccgatggggagaccgccaag
ggaaagccgatagctatctactatggttcaaatacaggaacttgtgaggcgctggctaat
cgccttgccagtgacgctgcacaacatggcttcaccgcagaggtggtagacactttggac
actgtgcgcgggaatctaccgaccgataagcctgtcgtaatcgttacgccgtcttatgag
ggagctcccgcagataatgcagcgcattttgtcagctggctaggcaccctgaaggagaaa
gagctggaaaatgtttcatacgcagtcttcggatgtggccaccgtgattgggcgaagaca
tatcagaagatccccaagtacatcgacgccactttggaagaacgcgctgcgaccaggcta
gccgacatgggtgttgctgatgccgcagaaggcgacatctttactgcattcgagacttgg
gaagaccagatcctgtggccggctctacgcgccaagtacggatcagagcaagcgactggc
gaaggctcgttggagactaatctcgacgtcgaaatttcagcacccagatcgtctacgctc
cgtcaagatgtctacgaggccgttgtagagaatgttcaggttctttcaacatctgatgtg
agtgagaagaggcatatcgagatcagcctcccatcaagtatgtcatacacagcgggtgat
tatctggccatcctgcctttgaaccccaagcaaaacattcagcgcgccatgcgatacttt
ggcttaacttgggattcaatgctcaccatatctacgaatggcccaaccacattgccaacc
gatataccgattagcgccaatactgtccttggggcttacgtggagctcgctcaacctgcg
agcaaacgtaatgtccaagccctggtcgatactacaaccgacgagtccgaaaagaaggaa
cttatccgcctagctgacgaagcattcagctcagagattacagcgaagcgtgtatccatt
ctcgacctcctcgagcaattcccatccaccaagctaccactcggtgtctttctgaaaatg
ctgccccctatgcgcgtacgacagtactccatctcatcgtcgcctatctggaatccttcc
aacgtcacactcacatactccgtcgtgaatgatgtggctctaagcggtcgcggacgccac
gtgggcgtcgctacaaactatctcgccaaccttacagcaggtgatagactacacgtcagc
gtacgccagtctcacaaagcgttccacctaccaaaggaccctgagaagataccaatcatc
atgattgcagctggcacaggccttgcacccttccgtggcttcatccaagaacgtgcggcc
caagtagcagctggccgcaaccttgccccggccattctcttctacggctgccgaacaccc
acaaccgacctcatatacgccgatctactcaagcggtgggaggacatgggcgcagtatcc
atccgctacgccttttcccgccaatccgaggattctcatggctgcaagtatgtgcaagat
cgcgtataccacgatcgggctgatgtgatcaaattgtttgatgcgggtgccaagctcttt
gtgtgcggctcgcgtaacgtaggcaatggtgtacaggagacgctcatcagagtggcaaag
gagaggcactttgagaaggaaggtgttgaagctgacgatgcgaaggcaagggcgtggttt
gatgagctgagaaacgagaggtttgctacggatgtcttcgagtag

DBGET integrated database retrieval system