KEGG   Pyrenophora teres: PTT_08706Help
Entry
PTT_08706         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pte  Pyrenophora teres
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTT_08706
   01212 Fatty acid metabolism
    PTT_08706
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PTT_08706
   00650 Butanoate metabolism
    PTT_08706
  Lipid metabolism
   00062 Fatty acid elongation
    PTT_08706
   00071 Fatty acid degradation
    PTT_08706
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PTT_08706
   00310 Lysine degradation
    PTT_08706
   00380 Tryptophan metabolism
    PTT_08706
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTT_08706
Enzymes [BR:pte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PTT_08706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 245 aa AA seqDB search
MGVQLNRPKALNALCTPLILEINQALRDFQNDKSIGAIVLTGSDRAFAAGADIKEMKDLT
FSDAYGNDFIESWSDLVTFLKKPLITAVNGYALGGGCELAMMGDIMYAGPKATFGQPEIK
LGVIPGAGGSQRLTKAIGKSRAMEVILTGDNISAQQAGEWGLVAKVFETPEECVNGAIAT
AEKIASYSQIAVKAAKEVVNKSQDLGIREGVEYERRVFHGLFGSEDQKIGMTAFAAKDKA
KWTHK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggagtccagcttaaccgccccaaagccctcaacgctctgtgcacaccactcatcctc
gagatcaaccaagctttacgcgacttccaaaatgacaagtctatcggcgccattgtcctt
accggttcggacagggccttcgcagcaggtgcagacatcaaggagatgaaggacctcaca
ttcagcgatgcatacggcaacgacttcatagagtcatggtcagacctggtcacattcctc
aagaagccactcatcactgctgtcaatggatacgcgctgggcggaggttgtgagctggcc
atgatgggtgacatcatgtacgcgggacccaaggctacgtttggccagccggagatcaag
ttgggtgtcatacctggtgctggcggatcgcagcgtctcaccaaggcgattggaaagtcg
agagccatggaggtcatccttactggcgacaacatttctgcgcagcaagctggcgagtgg
ggacttgtcgccaaggtttttgagacacccgaggagtgcgtcaacggtgctatcgcgacg
gcagagaagattgcatcttacagtcagattgccgtcaaggcggccaaggaggttgtgaac
aagagccaggacctgggtatccgggagggtgttgagtatgaaaggagagtcttccatgga
ctgttcggaagtgaggatcagaagattggaatgactgcttttgcggccaaagacaaggcc
aagtggacacataagtaa

DBGET integrated database retrieval system