KEGG   Pyrenophora teres: PTT_08708Help
Entry
PTT_08708         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pte  Pyrenophora teres
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PTT_08708
  Replication and repair
   03420 Nucleotide excision repair
    PTT_08708
Transcription machinery [BR:pte03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PTT_08708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 482 aa AA seqDB search
MSASSSTQALEYLEGLPLATHKKLYEQPSTVLAVFRCMLPHLAKSIVMAMLYMPSPFPAA
DLDAWFKPSARKEKERATFTLDRLHIITSVRQDNGTLSWTLSPGFQRSLRNAIEGSGTHR
SFGVPATKEESGKRVSVEFLDEYSRSQWEGILYYLVSGAAGLGKDNISRAEVSPSTKTLL
NTGDLVRTIHGSPRITKDGFSFVLQETNAQVWSLLIIYLKVTNELGMSETEVLAFLFMLG
SLELGQDYSTSTLSPTQLRMLDDLSSMGLIYRSDKNARTFYPTRLATTLTSDSGSAMSAS
SNDIAQAGQGNAGPSAAANKGFIIIETNYRLYAYTNSLIQIAILSLFTKLQHRFPNLVSG
KLTKESVHKAVQSGITSAQIISYLTTYAHPQMQKTVPYIPPTVMDQIRLWEYEGERVETT
PGYLMREFSSDTEYRDVMGYASALGVLVWQNDAARCFFVSQVEQISAYLKKKKENRESAR
GR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctcatcttctacccaggcgctggaatatctagaaggcctgcctttggcgaca
cataaaaagctgtatgagcaaccttcaacggtgctggcggttttccgctgcatgcttccg
catcttgccaaatctatagtcatggcgatgctctacatgccctcgcccttccccgccgcc
gaccttgacgcttggttcaagccctctgcgcgcaaagagaaggaacgtgcgaccttcacc
ctcgaccgtcttcacatcatcacctcagtacgacaagacaacggcactttatcatggacc
ctcagcccaggcttccagcgcagcttgcgaaatgcaattgaaggctccggtacgcatcgc
tcctttggtgtgccagcgaccaaggaagagagtgggaagcgggtgagcgtggaattcttg
gatgaatactcgaggtcacaatgggaaggcatcttgtactaccttgtaagcggtgcagcg
ggacttggtaaggacaatatttccagagcagaggttagcccgagcaccaagacgctgctg
aatacgggtgatcttgtgcggacgatacatgggagtccgaggatcaccaaggatggtttc
tcttttgtgctgcaagagaccaatgcgcaggtttggagtctgctcatcatttatcttaaa
gtgacgaatgaactcggcatgtccgaaaccgaagtccttgcctttctcttcatgctcggt
tcccttgaactaggccaggactactcaacatccactctctccccaacacagctccggatg
ttagacgatctctcttcaatgggcctcatctatcgctccgacaagaatgcgcgaaccttt
tacccaacccgtcttgccacgaccttgacctcagattctggcagcgccatgtctgcctcc
tcaaacgacatcgctcaagccggccaaggcaacgccgggccatctgcagcagcaaacaag
ggtttcatcatcattgaaacaaactacaggctctacgcctacacaaacagcctcatccaa
attgccatcctcagtctcttcacaaaacttcaacatcgcttccccaaccttgtctccggt
aaactgacaaaagaatccgttcacaaagcggtccaatccggcattacatccgctcaaata
atctcctacctcaccacctacgcccacccacagatgcaaaaaacagtgccgtacatcccg
cctaccgtcatggaccagatacgcctctgggaatatgagggcgagcgtgtggaaaccacg
ccgggttacttgatgcgcgagttcagttccgacacagagtatagggacgtcatgggctat
gcgagtgcgctgggcgtgctggtgtggcagaatgatgcagcgaggtgcttttttgtgagc
caggtggagcagattagtgcgtatttgaagaagaagaaggagaatagggagagtgctagg
ggtcggtga

DBGET integrated database retrieval system