KEGG   Pyrenophora teres: PTT_08861Help
Entry
PTT_08861         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pte  Pyrenophora teres
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PTT_08861
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PTT_08861
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PTT_08861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1112 aa AA seqDB search
MSLLHDSYARPRMPSPSPSFHRAVTIPARASPALTASYYNGSLQSTPEGIVPVSSSLPAI
PSYTLPESLLPPPVASPAPTSSPSAMAEALGKGPGLIRRVSRGAQGIPNRFRRGNANTQR
DKSSGPVIMRRRSDSRTAADAEAPLSDFDAFEEEEAIEDPFEPCLGLGISNSTPSISSIP
DAAVVAPVRNARLEQGTVLRKITKKEKKEINLRLDLESAKVFWDPSRPSKAFYIDDVKEI
RSGPEAKHYREECGLSENWAPYWFTIVYTDTTRSKGRIRTMHLIAPDVGIFNMWTQTLES
VSRNRIDLMAGLLGFADKSAKLVWQRAMKKRGESEESLDFPSTVELCRSLHINCTEATLR
AYFQKADTLDAGKLNQSQFLSFVRRLKERKDIKMIYKSYTSGSKIEMDKVTFFSFLQKEQ
GIDVNTDLDYWTATFEKFARATRPRATATPTEGGEVPLPLSMNFPGFQTYLTSAANHPLR
SVGKKQELNRPLNEYYISSSHNTYLLGRQVAGESSTEAYITALQKGCRCLEIDCWDGADN
IPVVMHGRTLTKSILFQDTIKVINKYAFTESPYPVILSLEVHCSAIQQSAMAKIMIQEFG
DKLVLQPLDFESQSLPSPEELKHRILIKVKAAAGEDFDTRALVGEITSRRQRSYSSPWSR
PVHLNDNLIPNSPLLSSPSSFSPPERAATFWATPRTSNNTLPTSAVVSSAEDSDSPNVTT
AETTELADDRRKPKKNKTSNITRELGNLGVYTKGVKFNDFASASANTYNHVFSINERAFD
KLTKPGAREKHLLEEHNMRCLMRVYPHAFRINSSNFDPLKCWRRGVQMAALNWQTYDLGQ
QLNEAMFASGDDRTGYVLKPAALRLESPNIDHKKAPKKEVKFTVQIISAQQLPRPRGLGQ
EANINPYVEFEMYCAEDMGANATGVGGQDASARNGHSGIGNPLRKRTRIVEGNGYNPEFG
NEIDMTVTTRYPSLVFVRWTVWNSLDARTTNHAPLATFTAKLSSIQQGYRHLPLYDSNGE
QYLFSTLFCKIKKQDIVDAPEPSGIASCGSSIEPASPLQEPTSAKSSRNFVRRLISRAPS
ERRRRKDEQQRTGSESRESDFDTISRSSTFER
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgctccacgactcgtatgcgcgaccgcgcatgccctcaccctcgccctccttc
caccgcgccgtcaccattcccgcccgtgccagtcccgccctgacagcctcctactacaat
ggctccctccagtccactcccgaaggcatcgtccccgtctcatcctcgttgcctgccatc
ccctcctacaccctgcccgagtcgctactgccgcctcccgtcgcatcacccgctcccacc
tcgtcgccctcggccatggctgaagctctcggaaagggccctggcctgattcgacgagtg
agccgtggcgcacaaggtatccccaaccgcttccgtcgcggcaacgcaaacacacagcgc
gacaagagctctggtcccgtcattatgcgccgtcgcagcgacagcaggactgccgctgac
gccgaagcccccctctccgactttgacgcctttgaggaggaggaggccattgaagatccc
tttgagccctgccttggccttggcatatcaaactcgacccccagcatcagctccatccca
gacgccgccgtcgtcgctcccgtacgcaacgcccgcctcgaacaaggaaccgtcctaagg
aagattaccaagaaagagaagaaggaaatcaacctacgccttgatcttgaatccgcaaag
gtcttctgggacccttcaagaccctcaaaggccttttacattgatgatgtaaaggagatc
cgctcaggcccagaggccaagcactaccgcgaggagtgtggtctctcggagaactgggca
ccctactggtttaccatcgtctacaccgacaccacacgctcaaagggccgcataaggacg
atgcacttgattgcacctgatgttggcatcttcaacatgtggacccagacactcgagtca
gtatcacgcaaccgcattgacctcatggccggcctccttggctttgccgacaagagcgcc
aagctcgtctggcaacgtgccatgaagaagcgaggcgagagcgaagaatctctcgacttc
cccagcactgttgagttgtgccgcagcctgcacatcaactgcaccgaagccacactccgc
gcctatttccaaaaggccgatactttggatgccggaaaacttaaccagtcccagttcctg
tcttttgtccgacgcctaaaggaacgcaaggatatcaagatgatctacaagtcatacacc
tctggatccaagattgaaatggacaaggtcactttcttctccttcctgcagaaagagcaa
ggcatcgatgtcaacacagacctcgactactggacggccacgtttgaaaagtttgcccgc
gcaacaagaccaagggcgactgccaccccgaccgaaggcggtgaagtcccactaccattg
tcgatgaacttccctggtttccagacatacctcacatctgctgccaaccaccccctgagg
tcggttggtaagaagcaagagctgaaccgacccttgaatgagtactacatctccagctct
cacaacacataccttctcggtagacaagtcgcgggcgagtcaagcaccgaggcctacatt
accgcgcttcagaagggctgccggtgcctcgagattgactgttgggacggtgctgacaac
atccccgttgtgatgcacggccgcaccttgaccaagagcatcctgtttcaggacaccatc
aaggtcatcaacaaatacgcctttacagagtcgccctacccggtcatcctttcgctcgaa
gtgcactgctccgcgattcaacaatctgccatggccaagatcatgatccaagaattcggt
gacaagctggttcttcagccactcgactttgagtcacagtcgcttcccagccccgaggaa
ctgaagcatcggattctaattaaagtcaaggctgcagctggtgaagactttgataccagg
gctctcgtgggcgaaatcacgtcccgaagacagcgcagctacagctctccctggtcccga
ccagtgcatttgaacgacaaccttattccgaactcgcctcttctttccagcccctcttcg
ttcagcccaccagaacgagccgctacgttttgggcaacaccgcgaacttcaaacaacacg
ctacccacttcggccgttgttagctcagctgaagacagcgacagcccgaatgtgactacc
gctgaaaccaccgagcttgcagatgaccgacgcaagccgaagaagaacaagactagtaac
attacaagggagcttggcaatcttggtgtgtacactaaaggagtcaagttcaacgacttt
gctagtgcaagtgcgaacacttacaaccacgtcttctcgatcaacgagcgagctttcgac
aagcttaccaagcctggagctcgtgaaaagcacctgctcgaggaacacaacatgcggtgc
ctcatgcgtgtataccctcacgctttccgcatcaactcgtcaaactttgatcccctcaag
tgctggcgtcgcggtgttcaaatggctgctctgaactggcaaacgtacgatcttggccaa
cagctaaacgaagccatgtttgcgagcggtgacgaccgcactggctacgtcctcaagcct
gccgcgctccgcctggagtcgcccaacatcgaccacaagaaggctcccaagaaggaagtc
aagttcactgtgcagatcatctcggctcaacagctaccgcgcccccgtggtctaggccag
gaagccaacatcaacccgtatgtcgagtttgagatgtactgcgcagaagacatgggtgcg
aatgctactggtgttggcggacaggatgcgtcagctcgcaacggccattctggaatcggc
aaccctctgcgcaagcgaactcgcatcgtcgagggcaatggatacaaccccgaattcggt
aacgaaattgacatgacagtcacgacaaggtaccccagtcttgtcttcgtccgctggact
gtctggaactcgctcgatgcacgcacaaccaaccatgcccctcttgctacctttaccgcc
aagctcagcagcatccaacagggttaccgtcatctcccgctctacgacagcaatggcgag
cagtacctgttctccactctgttctgcaaaatcaagaagcaggacattgtcgatgcaccc
gaaccttcaggcatcgcttcctgcggatcgtccattgagccggctagcccgcttcaagag
cctacaagcgccaagtcgagccgcaactttgtcaggcgtttgattagccgtgcgcccagt
gagcgcagaagacgtaaagatgagcagcagcgcacaggaagcgagtcgcgcgaatccgac
tttgacacaattagccgctccagtacctttgagcgataa

DBGET integrated database retrieval system