KEGG   Pyrenophora teres: PTT_09480Help
Entry
PTT_09480         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pte  Pyrenophora teres
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTT_09480
   01230 Biosynthesis of amino acids
    PTT_09480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_09480
   00051 Fructose and mannose metabolism
    PTT_09480
   00562 Inositol phosphate metabolism
    PTT_09480
Enzymes [BR:pte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PTT_09480
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PTT_09480
  Exosomal proteins of bladder cancer cells
   PTT_09480
  Exosomal proteins of melanoma cells
   PTT_09480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 255 aa AA seqDB search
MPPMTRPRRIVGVSLKMYFDLPSTLSYVRGVLQLDGDAWNSRIDLFVIPDFVSLTESARI
LESSSIMLGAQDCMWEDKGAYTGEVSPLVLRQAGARIVEIGHAERRAMFGETDDTVANKA
GAAARNGLIPLVCIGEKTHHSVASAAVGAAIQECRPQVTSVLAAVPDDTEIILAYEPVWA
IGAKEPADADHVVNVTKELRKMAAGRKGVTRIVYGGSAGPGTFAKIAQGVDGLFLGRFAH
DIHNLKKVIEEVGGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccacccatgacccgccctcgtcgcatcgtcggcgtctcgctgaagatgtacttcgac
ctgcccagcaccctctcctacgtccgcggcgtcttgcagcttgacggcgacgcctggaac
tcgcgcatagacctattcgttatccccgactttgtctccctgaccgaatcagcccgcatc
ctcgaatcctcgtcgatcatgcttggcgcccaagactgtatgtgggaagacaagggcgcg
tacacaggagaagtcagtccgcttgtgctgcggcaggcgggtgcgaggatagtagaaatt
ggacacgcagagcggagagccatgttcggtgagacggacgacacggttgcgaacaaggcg
ggcgctgcagcaaggaacgggctgataccgctggtgtgcattggcgagaagactcatcac
tctgtcgcatcagcagctgtgggtgcagcgatacaagagtgtaggccacaagtcacttcg
gtgcttgctgcagtgccggacgacactgagatcatactggcctatgagcctgtgtgggcc
attggcgcaaaagagcctgctgatgcagaccacgtagtcaatgtgacaaaagagctgagg
aagatggctgcaggtaggaagggagtcacaagaatcgtctacgggggaagtgctgggcca
ggcacttttgccaagattgcccaaggtgtcgatggcttgttcctgggtcgtttcgcccat
gacatccataacctgaagaaggtcatcgaggaagttggtggagcgtag

DBGET integrated database retrieval system