KEGG   Pyrenophora teres: PTT_09480Help
Entry
PTT_09480         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pte  Pyrenophora teres
Pathway
pte00010  Glycolysis / Gluconeogenesis
pte00051  Fructose and mannose metabolism
pte00562  Inositol phosphate metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01200  Carbon metabolism
pte01230  Biosynthesis of amino acids
Module
pte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pte_M00002  Glycolysis, core module involving three-carbon compounds
pte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_09480
   00051 Fructose and mannose metabolism
    PTT_09480
   00562 Inositol phosphate metabolism
    PTT_09480
Enzymes [BR:pte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PTT_09480
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PTT_09480
  Exosomal proteins of bladder cancer cells
   PTT_09480
  Exosomal proteins of melanoma cells
   PTT_09480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: EFQ93204
UniProt: E3RM41
Position
Unknown
AA seq 255 aa AA seqDB search
MPPMTRPRRIVGVSLKMYFDLPSTLSYVRGVLQLDGDAWNSRIDLFVIPDFVSLTESARI
LESSSIMLGAQDCMWEDKGAYTGEVSPLVLRQAGARIVEIGHAERRAMFGETDDTVANKA
GAAARNGLIPLVCIGEKTHHSVASAAVGAAIQECRPQVTSVLAAVPDDTEIILAYEPVWA
IGAKEPADADHVVNVTKELRKMAAGRKGVTRIVYGGSAGPGTFAKIAQGVDGLFLGRFAH
DIHNLKKVIEEVGGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccacccatgacccgccctcgtcgcatcgtcggcgtctcgctgaagatgtacttcgac
ctgcccagcaccctctcctacgtccgcggcgtcttgcagcttgacggcgacgcctggaac
tcgcgcatagacctattcgttatccccgactttgtctccctgaccgaatcagcccgcatc
ctcgaatcctcgtcgatcatgcttggcgcccaagactgtatgtgggaagacaagggcgcg
tacacaggagaagtcagtccgcttgtgctgcggcaggcgggtgcgaggatagtagaaatt
ggacacgcagagcggagagccatgttcggtgagacggacgacacggttgcgaacaaggcg
ggcgctgcagcaaggaacgggctgataccgctggtgtgcattggcgagaagactcatcac
tctgtcgcatcagcagctgtgggtgcagcgatacaagagtgtaggccacaagtcacttcg
gtgcttgctgcagtgccggacgacactgagatcatactggcctatgagcctgtgtgggcc
attggcgcaaaagagcctgctgatgcagaccacgtagtcaatgtgacaaaagagctgagg
aagatggctgcaggtaggaagggagtcacaagaatcgtctacgggggaagtgctgggcca
ggcacttttgccaagattgcccaaggtgtcgatggcttgttcctgggtcgtttcgcccat
gacatccataacctgaagaaggtcatcgaggaagttggtggagcgtag

DBGET integrated database retrieval system