KEGG   Pyrenophora teres: PTT_09598Help
Entry
PTT_09598         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pte  Pyrenophora teres
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_09598
Enzymes [BR:pte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PTT_09598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 320 aa AA seqDB search
MVDRANRPSALNAPTASGPGPQVDIVGEGGSQKVVARLPSGESVEVLLFGATVTSWKSNE
GKTENLWLSDAADLTGKKPVRGGIPVVFPVFGPPPKSGHPTSSLPQHGFARGSRWEYMGK
STAEDALDSDSVKLDFGLDRQSLSEESRKAWPLDFGLVYSVTLSKDSLQAVLTVRNEGEE
SFEFQFLLHTYFKISDISKVAITGLSGTEYIDKVLNASTHTQSDNQLKITGEVDRVYKNI
KQDTTSITEDGKPRFDVIRDNVKDTVTWNPWIEKAKAMGDFSPDDGYKNMVCVEIGAVDG
WQKLEKGEVWEGGMLVKSHL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaccgtgcgaaccgcccttctgccttgaatgcacccactgcttctggtcctggc
cctcaggttgacattgtcggagaaggcggcagccagaaggtcgttgcgagacttccgtca
ggcgagagtgtcgaggtgctgctctttggagctaccgtcactagctggaaaagcaatgag
ggcaagacggagaacctgtggttgagcgacgctgctgatcttactggcaagaagccagtg
agaggtggcattcccgtggtattcccagtctttggtcctccccccaagtcaggacaccca
acttcatcgcttccccaacacggctttgctcgcggatcgcgctgggagtacatgggcaag
tcgactgctgaagatgcgctcgattcggattctgtcaagctcgactttggcctcgaccgt
cagtctctgagcgaagaatcgcgcaaggcgtggccgctggactttggccttgtgtacagc
gtcacactaagcaaagacagcctacaggccgtacttactgtccggaacgagggcgaggag
agctttgagttccagttcctgctccatacctatttcaagatttcagacatctccaaggtc
gccattaccggcctctccggcaccgagtacattgacaaggtccttaacgcatcgacccac
acacagagtgataaccagctcaagattaccggcgaggtcgatcgcgtctacaagaacatc
aagcaggatactacatcgattactgaagatggcaagcctcgcttcgacgtcatccgcgac
aacgtcaaggacacagtcacctggaacccttggatcgaaaaggccaaggccatgggcgac
ttctccccagacgacggctacaagaatatggtttgcgtggagattggtgccgtcgatggc
tggcaaaagctggagaagggtgaggtctgggagggcggcatgttggtcaagagccacctc
tag

DBGET integrated database retrieval system