KEGG   Pyrenophora teres: PTT_09652Help
Entry
PTT_09652         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 524 aa AA seqDB search
MDDDHYPELQLPESRVLIVITGGTICMRKSVDGLVPARGFLKAGLAPRPVFNDGSYPEPL
EIVVDDRGTRKAVQSLRTPVSTYERRVRYCVLEFEKLLDSSSIDSTGWDQIARTVQRNYQ
LFDGFVILHGTDSLAYTSSALSFMFHNLGKPVILTGSQAPMMNLQTDAQDNLLNSLIIAG
HFMIPEVCLFFNFKLFRGNRATKVSAEDFDAFGSPNLPPLATVSSTRTNVLWHRVHRSTD
LSPFTIQTSLDTAHVACLRVFPGITPVMVDAVLRLEGLKGLVLETFGAGNTPGGPDSAMT
RCLADAVKRGIVIVNVTQCLSGSVSALYAPGAFLGRAGVVFGQDLTSEAALTKLAYLLAL
PDATPEEVAKRMSISLRGELTETTRTHFEHPSRSGVLTPELSSLTALGYAVQKGDLQATK
DIIRGEPRWLLNDADYQMNSPVHLAATSPNVEILRDFLAQGASVHLRNRSGNTPLFLAAA
AGLPDHVQTLIDAGAHLHSDEVSAAKLHASEGDGNAEVWARVIG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgaccactaccccgagttgcagctcccagagtcgcgagtgctgatcgtcatc
acaggcggcacgatatgcatgcgaaagtctgtagacggcctggtccccgcacgaggcttc
ctgaaggccggactcgcccccaggccggttttcaatgacggctcttacccggagcccctg
gagattgtcgtcgatgacagaggcacacgcaaagctgtccagagtctccgaactccagtc
agtacctatgaacgccgagttcgatactgcgtgctcgaatttgagaagctactcgacagc
agctctattgactctaccggctgggatcaaattgcccgcacagttcaaagaaactaccag
ctattcgatggcttcgtcatcctacacggaacggattctctggcgtatacttcgtctgca
ctgagtttcatgtttcacaacctggggaagccagtcattctgaccggatcccaagcgcca
atgatgaacttgcaaactgatgctcaggataatctcttgaattctctgattatcgctggc
cacttcatgatccctgaagtgtgcctcttcttcaatttcaaactcttccgaggaaaccgc
gctaccaaggtatccgcagaggactttgatgcgttcgggagcccaaacttaccaccactg
gctactgtctcttcgaccaggaccaatgtcctatggcacagagtccatcgatctaccgac
ctcagcccattcactattcagacgagtctagacacggcccatgtagcatgtctacgtgtt
tttccaggaatcacacctgtcatggtcgatgccgtcttgcgcttggaagggctgaaagga
ctggtattggaaacctttggagccgggaacacacccggaggaccggacagcgccatgacg
cggtgcttagcagacgcagtcaagagaggaattgtgattgtcaatgtaacccaatgctta
agcggcagcgtcagcgctttgtacgccccgggcgcattcctcggtcgggctggtgtggtc
tttggccaggacttgacatcggaggcagcgctcacaaagcttgcatatctactcgcacta
ccggatgccacacccgaagaggttgcgaagcgcatgtcgatatccttgcgcggtgagctt
actgagacgacacgaacacatttcgagcatccttccaggagcggcgtccttacccctgaa
ctctcgagccttacggcgctcggctatgctgttcaaaagggcgacttacaagcgacaaaa
gatattattcgaggagagcctcgctggttgctcaacgacgccgattaccaaatgaacagc
cctgtacatcttgcggcaacaagccccaatgtcgaaatcctgcgagactttctggcccag
ggcgcttctgtgcatctcagaaaccgatcaggcaataccccgctcttcttggctgcagcg
gccggcttaccagatcacgtacagacattgatcgacgcaggagcccatctacatagtgat
gaagtgagcgcggcaaagctgcatgcatccgagggcgacggcaacgctgaagtttgggct
cgtgtgattggatga

DBGET integrated database retrieval system