KEGG   Pyrenophora teres: PTT_09708Help
Entry
PTT_09708         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 607 aa AA seqDB search
MKTTSCLLVPSLAFQAVRAATWTPDIRADTNRDGIVDMVGSSDSGNKAAWSAERGAIFLP
NIGDKYLRCANTDKVGNALSNDELAACHDASGHLLLAPESVAPVRTVPMNVSDDVAARIY
VTPQEAYERTRLFVLDNPEDHNSTTSWRLVDQEFLFNATQLRAGIVLGIDGRELVTDLSV
WDGSVVIRFDVFDALNQSSDAVAMKMAPVLTHHHLQKVETLISTEGNSTDPIQQGFIRQL
ESARQAAGITNKMVLFNQSSDIWAQDFIEPGYASMPGPNGPVAIRVILRSAQSTRTAGRQ
VFEQLRGPGIGGFQPLSGSGSGFGHREINSFGNLETIPPYTSKSGKRYPAGRIIMGKHFE
MLPAAAMLDFLHGQQLQSPFILEAGWLVIGHVDEFVQFLPYKNELGFTIAIADTRSGLDL
LKKLQNDGHGGTRAISFEDDTGELQEPGLMDTIDQILSNTTFVEANTYAQRHIDANLQML
LAEIPLLAQDVIYVPTLFRDANVGIEPGSPDGLPPHSGPIMANERKLMAFHPASINGIVI
GSHYFSPKPWGPVINGSDALAHAVEVAYARAGMSVAYVDDFLSHHVGAGEIHCGSNTLRQ
TDAIWWA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacctcttgtctcttagtgcccagcctcgcctttcaggcagtacgggccgca
acatggacacccgatatccgcgccgacaccaaccgcgatggcattgtcgacatggtcggc
tcgtcagatagcggcaacaaggccgcttggagtgctgagcgtggtgccatcttcctaccc
aacattggtgataaatatctgcgttgtgccaacacagacaaggttggcaatgcgttaagc
aacgatgagctagccgcatgccacgacgcttctggacatctgctcctggctcccgagtcc
gtcgcacctgtccgtactgttccgatgaatgtctcagacgacgtcgctgcccgcatctat
gtcacgccgcaagaagcatatgaacgcactcgactgtttgtcttggacaatccggaagac
cacaactcaacgacatcatggcgtctggtcgatcaagagttcctcttcaacgctactcag
ttgcgcgctggaattgtccttggaatcgatggtcgcgaacttgtaacagacctgtcggtg
tgggatggatcggtggtgattcgcttcgacgtcttcgatgctctcaaccagtccagcgac
gctgttgcgatgaagatggcgccagtcctaacccatcatcatctgcaaaaggtagagact
cttatcagtaccgagggcaactccacggatcccattcaacaggggtttattcgccaattg
gagagtgctcgccaggctgctggtatcacgaacaagatggtacttttcaatcagtcttcc
gacatttgggcgcaagactttatcgagccaggttacgccagtatgccagggcctaatggg
ccagtggcaatccgtgtcatcctccgctcagcacaatcaacccgtactgcgggccgtcag
gtgttcgagcagctgcgtgggccaggcattggaggcttccagccactttctggctcaggt
tccgggttcggccatcgggagatcaacagttttggcaatttggagacgattcccccgtac
acttcaaagagtggcaagaggtaccccgctggacgcatcatcatgggtaagcattttgaa
atgctacctgcggctgcaatgttggactttctccatggccagcagttgcagtcgccattc
atactcgaggctggctggctggtaattggacacgttgatgagtttgtacagttcttgcct
tacaaaaacgaattgggcttcacgatcgctatagcagatacgagatcgggattggatctt
cttaagaagctccagaatgatggacacggcggaacccgtgcaatcagtttcgaggacgac
acaggagagcttcaagagccaggattgatggatacaatcgaccaaattctctccaacaca
acctttgtcgaggcgaatacctatgcgcagcgccacattgacgcgaacctacagatgctg
ttggcagagataccactgttggctcaggacgtcatctatgtgccaacactgttccgtgac
gcaaatgttggaattgaacccgggagcccagatggacttccgccgcactcgggacccatc
atggcgaacgaaaggaaactaatggctttccaccctgcctcgatcaatggaattgtcatt
ggaagccattacttcagcccgaagccctggggtcctgtgataaatgggtcggacgcgctt
gcgcatgcggtggaagtggcttacgcaagggctggaatgagtgtggcttacgtcgacgat
ttcttgagccaccacgttggagctggtgaaatccattgcgggtcaaataccttacgccaa
acagatgcgatctggtgggcgtag

DBGET integrated database retrieval system