KEGG   Pyrenophora teres: PTT_09871Help
Entry
PTT_09871         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PTT_09871
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PTT_09871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1249 aa AA seqDB search
MAPGKTAPRLLQDLFTYDPRHEERAGRNLLTSAPPQHDTKAPAVPAVPYRNCRHNLLVKQ
EQSLGLGPDGEIGRESAYRIASYCSKCRWHVDVLVQHQSGTAKIKSCGKGNQEYALHHFL
YHGEDGSNGSDRLEAQLRPRTYTFRCSAPECSVEVRISMKPPRFSEQDVDTLTNQAQLRR
RLEVAKRIAGERADTVMARRVDGPDYLNTYLQDSLNPTKGKARIPLLNKKFLKTFGRDCD
SILKRLGFENRQEEDDDGTLVEVWYLPKPEEPATTGATLRETIEDARYELNSIILDIPQS
ERVNCRHQPFDSSPARPYLEKALACADYAKAQGRETRNTNHEEDHPYYASLGAVGDFDDA
LILFAFSRQSALDIENKSYYFECLQDLAAGRKSEVLGMQVAMLASKGVTTKREAERAYQY
FGIDPAHAGVISDDHIIGSFRSRLSDISLIQAEEARKQLRVLGDVRDNDRIRAEASGSIE
TYEQAMAWFELEHDAADDFVQTMYSLKTQDNPAELETAQKALRVIADHRQSERLRNYLKF
GTISEPEMDLGDAYAAFNVADRSVALDPAVLESVLSTYDIGSSERERMERACGLIQQDQS
QRFGNQPSNSTMPVMRRNNYPLETWPVGLRNIGNTCYLNSVLQFLFTIKPLRELILNCEY
RMQDISPEALKDKKVGRIAVTAERVVTAQKFVRELRSLFERMITASTDTVQPAIDIASLA
LCKSDNPEESVQSPQADATKGTDLGTIDGAAVYGPMLPPSAEQFTSADVPVGSLINVDET
NPTDSDMKDGDAEPITPADSVMDDDTAARDHDSTKQSKPNDSDMPAPPTRPPPVPPRADP
KPAIKPAVPSSTKIGRIEESARQQDAAEVMANIFDLIRCAITGDSILREGEQGDAIKDLF
FGEVTTVMEKPGGTEKAHEFRDHFLVATGRRDRSLYATLDEDFGLSEIEGGGGSRYDYVE
RPAPIQIINVKRLQFEKGEAIYDRSHVGLEKVMYLDRYLAQTPTLSEDQLLELRKTQWAK
QKQLRELEAKRTKLQTTGLEGMNLPECLEASSDYINNLITERSEEQGHDAAALISLPTPP
PELSDALQNSAVDLATELSGIDAQISSLESEIDNVFHDCNSVPYRLHAIFTHRGDVKGGH
YWIYIYDFQSNEWRSYNDESVEKVVDEGEVLNKEDKIRPKVSAGVVYVRADLAEQYTQAV
CRQPERSDHQETNLDIEMKDFLVDSDDEMPALEPVDMTNIPVIEGVEKA
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggcccccggcaagacagccccacggctgctccaagatctcttcacatacgacccgcga
cacgaggaacgcgctggccgcaacctgttgacgagtgcgccgccgcaacatgacacaaag
gcaccagccgtcccagccgtaccctacaggaactgccgacacaacttgctcgtcaagcaa
gagcagtcgcttggtcttggcccagacggcgagataggccgggagtctgcctaccgtatt
gcttcatactgttcaaagtgtcgctggcatgtcgacgtgcttgtccagcaccaatctggc
actgccaagataaaatcttgtggaaagggcaatcaagaatatgccctgcaccatttcctc
taccatggcgaggacggttcaaacggcagcgacaggctcgaggcccagctacgaccacgc
acctacaccttccgctgctccgccccagaatgctccgtcgaggttcggataagcatgaag
ccgcctcgcttctccgagcaggacgttgataccctgacaaaccaggcccagcttaggagg
agattggaggtagcgaagcgcatcgctggcgagcgagccgacacggtcatggcacgtaga
gtcgatggccctgactacctcaacacatacctgcaggattccctgaacccgacaaagggc
aaagcgcggatacccttgcttaacaaaaagttcctcaagacattcggtagagactgcgac
tcgattctcaagcgtttggggttcgaaaaccgtcaagaagaagacgacgacggcaccctt
gttgaagtctggtacctccctaagccggaggagcccgccaccacgggcgcaacactacgc
gagactatcgaggatgctcgctatgagctcaactccatcatacttgacattcctcagagt
gaacgtgtgaactgcagacaccagccgtttgattccagcccagcaaggccctatcttgaa
aaggcactagcatgtgcagattatgccaaggctcagggacgggagacacgcaacacaaac
cacgaagaggatcatccctactatgctagtctaggtgcagttggcgactttgacgacgcc
ttgattctcttcgccttctcccggcaaagtgctttggacattgaaaacaaaagttactat
tttgaatgcttgcaggatctcgccgctggtcgcaagagtgaggtgcttggcatgcaggtt
gctatgctggcctcaaagggagttactactaaacgggaagcagagcgtgcataccagtat
ttcggcatcgacccggcccacgcaggcgtcatcagcgatgaccacatcataggctcgttc
agatcaagactatcagacatcagccttatacaggccgaggaggcgaggaagcaattgcga
gttctaggcgatgtgcgcgataatgacaggatacgagccgaagcgtctggttccatcgaa
acatacgagcaagccatggcatggttcgagctcgagcatgacgcggccgacgactttgtc
cagaccatgtattcgttaaagactcaagataaccctgcagagttggaaactgcgcaaaag
gcactgcgcgtgattgcagaccatcggcagagcgaacgactacgcaattacctcaagttc
gggaccatcagcgagcctgagatggatctaggcgacgcatacgcagccttcaacgtagct
gacagaagcgtggcgctcgatccggccgttttggagtctgtgctcagcacctacgacatc
ggttcgagtgaaagggaaaggatggagagagcttgtggcctcatccagcaagatcaatct
cagaggttcggcaaccaaccgtcgaactctaccatgccagtgatgcggcgtaacaactac
cctctagagacgtggccagtaggtcttcgcaatatcggcaacacatgctacctcaacagt
gtacttcagttcctcttcaccatcaagccactgagagaactcattcttaactgcgagtat
cgcatgcaagacatctcaccagaagctctaaaggacaagaaagtcggtcgcatcgctgtc
accgcggagagggtcgtgacagcgcaaaaattcgtccgcgaactgcgaagtttgttcgag
cgtatgatcaccgcctctaccgacacagtgcagcctgcgatagacattgcttcattagca
ctttgcaaatcagacaaccccgaggaatcagtacaatcaccgcaagcagatgctacaaag
ggcacagacctaggtaccattgatggagcggcagtctatggtcccatgctaccaccttct
gcggaacaattcacatctgctgatgttcctgtgggttctctcatcaatgttgatgaaacc
aatccgaccgactcagacatgaaggacggtgatgcagagcccatcacccctgcagactca
gtcatggacgatgataccgccgcgcgggaccatgattcaacgaaacagtcgaaaccaaat
gatagtgatatgcctgctccaccgacccggcccccaccggttccaccacgagcggacccc
aagccagccatcaaacctgctgtaccgtccagcactaagatcggcaggattgaagagagc
gctcggcagcaagatgcagcagaagtaatggccaatatatttgatcttatacgttgcgca
attactggcgacagcatcctgcgggaaggcgagcaaggggatgctatcaaggacctgttc
tttggagaggtcacgaccgtcatggagaaaccaggaggaacagagaaagcccatgaattc
cgagatcatttccttgtcgctaccggtcggcgcgatcgctcactctacgccacactagac
gaagatttcggtctaagcgagatagagggcggtggtggttcgagatatgactatgtcgag
cgccccgcacccatccagatcatcaacgtgaagcgattacaattcgaaaagggcgaggct
atctatgaccgttctcacgttggtctcgaaaaggtcatgtatctcgaccgatatctcgcg
cagacgcctaccctaagcgaggatcagttgctagaactccgtaaaacgcaatgggcaaag
caaaagcaattacgggagcttgaggctaagaggacaaagctccagacaacgggactcgag
ggcatgaatctccccgagtgtcttgaggccagtagcgactatattaacaatctgatcaca
gaaagatcggaagaacaaggtcacgacgcagcagcattaatttcactcccaacaccacct
cccgaactatccgatgctctccaaaacagcgccgtggacctcgctaccgaactctctggc
attgacgcccaaatcagcagcctagaatcagagattgacaacgtcttccacgattgcaac
tcggtcccctaccgtctccacgccatcttcacgcaccgtggcgacgtcaagggcggccat
tactggatctacatctacgacttccagagtaacgaatggcgcagctacaacgacgagagc
gtggagaaggtggtagacgagggcgaagtgctaaacaaggaagacaaaatccgccccaaa
gtcagcgctggcgtcgtctacgtaagggccgatctcgcggaacaatacacacaggccgta
tgcaggcaacccgagcgcagcgaccatcaggaaaccaacctagatatcgagatgaaggat
ttcctcgttgattcagatgacgagatgcctgctttggagcccgtggatatgactaatatc
ccggttattgaaggcgtggagaaggcgtaa

DBGET integrated database retrieval system