KEGG   Pyrenophora teres: PTT_09949Help
Entry
PTT_09949         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1420 aa AA seqDB search
MRTASQLPLVSGHTHPNPLASHAPAPLAMNGSAHPSAPADVAVSTRPGTAAAATAASGLS
ASDMDHNAPPARPASTGQPSVRPGFGRAKSDFGPRHAAGPESAADEGSVDGHFKIRHGWD
DQLNSEEYSNLLTSNFFMYYTDKKHESGGHPKHEDTAFPVQEWRMRDRLKTVSAVLALCL
NIGVDPPDVIKTNPCAKEECWIDPTVTSQTPGHTPMNQIGKALQTQYEQLSMRTRYKLLL
DPTTEETRKYTSTLRRNARNERVLFHYNGHGVPKPTSSGEIWVFNRNYTQYIPLSLYDLQ
SWIGAPSLFVYDCSDAGLIITNFNRFAEKHQTEFEEARRRDPSVEHVDFSDCIHLAACRD
KESLPTNPELPADIFTSCLTDPITMAVRFFILQNPLPTKVSLRDAHNIPGKVSERRTPIG
ELNWIFTAITDTIAWNSLSKPLFKKLFRQDLMVAALFRNYLLAQRVMRAYHCHPVSHPEI
PQTHDHPLWRSWDLAVELILAQLPDLQAEARGEKEYVYKHSDFFAEQLTAFEVYLTQGAV
EQKVPEQLPIVLQVLLSQVHRLRALILLSSFLDHGPWAVNLALSIGIFPYVLKLLQSQAN
ELKPVMVFIWARILAVDQSCQADLLKDNGYQYFINIFNPNSGIPIQNASEHRAMCAFIVS
IFCKDYNQGQRASLSVELVESCLDHVKDVQNPLLRQWSCLCLSKLWVNYEEAKWVGIRCM
AHERLCELVVDPVAEVRAAMLHALAAFLGIRDVTPQVANIEESIASMILIMTMDGNSMVR
KELLIFFSTFVARYKTRFIVAAFEQLSEEHSDIKPRQPESGDALYMKTRTGASGSISESS
SCSQNTIYAAIWKELLVMSVDPHPEIAKDAGIVVDYILISLMESSLAKFAQPQLDEALQH
VPTPRPTRRVQEEGSVPQKASNPPTPTKDSTYLSLFGGIRKSTSVGASLKSLWAGQDPSA
PRQKPGKTAGEDSHVPAVSRPQTPERYHVEEQPMSRGFKSRNLSEKPEIPLKSTFYEWSV
EYFREPQMKPTEADEPGSTDYNGRLWRRNRNDRIIAETQPLKEIAVSNRWDVPRGYVDNL
SQPAKMCFHQFEDHLVVTDTRDTVNIFDYSKSVSRINCFSNGNPPESKITEVRFINEDDQ
ALLMTGSSDGVIKIFRNYDRKGETELVTGFRALTDLVPSNKNAGLVFDWQQGRGLILVAG
DVKVIRVWNAGTEVCTNDLPARSGSCITSLTSDQVEGDVFVAGFGDGAIRVYDQREKPAT
AMVKVWKEHKQWITNVHLQRGGQRELVSGCRGGEVKLWDIRWDRSVKTIQATSDTLKTLS
VHEHAPVFATGTQRHRVKIFNINNGEPVSHFEPYSGFLRDRSAPISVTAFHPHRLMIAAA
AVHDTHVNIFSCLEPKHSAVKTVKLWDGNASTSSRASTLG
NT seq 4263 nt NT seq  +upstreamnt  +downstreamnt
atgcgaactgccagccaactgcccctcgtcagtggccacacacacccgaacccgcttgcc
tcgcacgcccccgcacctctcgccatgaacggctctgcgcatccttctgcgcctgcagac
gttgcagtctcgacgcgccccggcaccgctgctgctgctactgctgccagtggcttgtct
gcttcagacatggaccataatgccccgcccgcccgtcctgcctcgactggccaaccgtct
gtccggccaggatttggacgggccaagagtgactttggacctcgccatgctgctggcccg
gagagcgccgccgacgagggcagtgtcgatggccatttcaagattcgccatggctgggat
gaccagctgaactcggaagagtacagcaacctgcttacctcaaacttcttcatgtactac
accgacaagaagcacgagtccggcggtcaccccaagcacgaggacacggcttttcctgtc
caagaatggcgaatgcgcgaccgcctcaagactgtctcggccgtccttgccctctgcctc
aacataggcgtcgatccgcccgacgtcatcaagacgaatccatgcgccaaggaagagtgc
tggatagacccgaccgtcacctcccagacgccaggtcacacacccatgaaccagattgga
aaggccctgcagacgcagtacgagcagctgagcatgcgcacacgctacaagctcctgctc
gaccctaccacagaagagacgaggaaatacacatcgactcttaggcgcaatgcccgtaac
gagcgagtcctgttccactacaacggccacggcgttccgaaacccacatcctcgggcgaa
atctgggtcttcaaccgaaactacactcagtacatacccctgtcgctttacgacttgcag
tcatggatcggggcgccgagtctgtttgtctacgactgctccgacgctggccttattatc
acaaacttcaaccggtttgccgagaagcaccagaccgagtttgaagaagcccgacggcgg
gatcccagtgtcgagcacgttgacttcagtgattgcatccatctggcagcgtgcagagat
aaggaatcccttcctaccaacccggaactacctgctgacatcttcacttcctgcttgact
gaccccatcaccatggccgtgcgcttcttcatattacagaacccacttccaacaaaggtc
agcttacgagatgcccacaatattccaggcaaggtctctgaacgtagaacgcccattggc
gaactgaactggatctttacagccatcaccgacaccattgcttggaactctctttccaag
cctctcttcaagaagttattccgtcaagacttgatggttgctgccctattccgcaactat
cttctcgcccaacgtgtcatgcgtgcctaccactgccaccctgtctcgcatcctgaaatc
ccacagactcatgaccatccattatggcgcagttgggatctcgccgttgagctgattctg
gctcagctaccagatctccaagcagaggctcgtggcgaaaaggaatacgtctacaaacat
tctgatttcttcgccgagcagttgaccgctttcgaagtgtacctcacccaaggcgcagtc
gaacagaaggtcccagaacaacttcccatagtgctccaagtattgctgagtcaggttcat
cgactccgcgcgctaattttgctatcgagtttcttggaccacggcccgtgggctgtgaat
cttgcactgagcattggcatctttccatatgtgctgaaactactacaatctcaagcaaac
gagctcaagccagtcatggtattcatttgggctcgaattcttgcagttgatcaatcctgc
caagccgatcttctcaaagacaacggttatcaatatttcatcaacatattcaaccccaac
tctggcataccgattcagaacgctagcgagcatcgcgccatgtgtgccttcattgtctct
atattctgtaaagactacaatcaaggccagcgtgcctcactgagcgtcgagctcgtagag
agctgtctagaccatgtcaaagacgtgcaaaacccattgctgaggcaatggtcatgcctt
tgcttaagcaagctctgggtcaactacgaagaagccaaatgggtaggaatacgatgcatg
gcacatgaacgactgtgcgagcttgttgtagatcccgttgcagaagtcagagcggcaatg
ctacatgccttggcagctttcctcggcatccgcgacgttactcctcaagtagctaacatt
gaggagtcgatcgcatcaatgatcctcatcatgaccatggacggaaacagcatggtgcgc
aaagagctcctcatcttcttttccaccttcgttgcccgctacaagacacgcttcattgtc
gcagctttcgagcaactttccgaggaacatagtgacataaaaccaaggcagcccgagagc
ggcgacgcgctttacatgaagacacgtaccggggcatcaggtagtatctccgagtcatca
tcctgttcgcaaaacacaatatacgcagcaatatggaaagagctgctggtcatgtcagtt
gacccacatcctgagatagcgaaagacgctgggatcgtcgtagattatattttaatctcg
ctcatggagtcctcgctggccaagttcgcacagccacaacttgatgaagctctccagcat
gttccaacccctcggccaacgcggcgcgttcaggaggaaggctctgttccgcaaaaggct
tccaaccctccaacaccgacaaaggattctacctacctctccctttttggtggtattaga
aaatccacaagcgttggtgcttcgctcaaaagtctctgggcagggcaggatccatctgcc
cctaggcaaaagcctggcaagactgccggcgaagactcccatgtgcctgctgtatctcgc
ccacaaacaccggaaaggtatcacgtcgaagaacagcccatgtcacgagggttcaaaagc
cggaacctgagtgagaagccggaaatcccactcaagagcacattctacgagtggtcggtc
gagtacttccgcgagcctcaaatgaagccgacagaggccgacgagcctgggagtacagac
tacaacggcaggctttggcggagaaatcgcaatgacagaattattgccgagacccagcca
ttgaaagaaattgctgtttccaaccgctgggatgtaccacgaggatacgtcgacaacctc
agccagcctgcaaagatgtgtttccatcagttcgaagaccatcttgtcgtaacggacaca
cgggatacggtcaacattttcgattattcaaaatcggtcagcaggatcaactgcttctct
aatggaaaccctcctgaatcaaagatcaccgaagtgcgattcattaacgaggacgatcaa
gcactgttgatgaccgggtcatcagatggagtgatcaagatatttcgcaactacgatcgc
aaaggcgagacggagttagtcacgggattccgagctctgacagatcttgttccaagtaac
aagaatgccgggctagtctttgactggcagcaaggcaggggcttgattctcgtcgccggc
gacgtcaaggtcatccgcgtgtggaacgcaggaaccgaagtgtgcacgaatgacctcccg
gcgcgttcgggctcctgtatcacgtctttgacctctgatcaagtggagggtgacgttttc
gttgctggtttcggtgacggtgccattcgagtgtacgaccaacgtgagaagccagccact
gccatggtcaaagtctggaaagaacacaaacaatggatcaccaacgtccacctacagcgt
ggtggtcagcgtgagctcgtgagcggctgtcgtggtggcgaagttaaactatgggacatt
cgctgggatcgaagcgtgaagacgatacaggcgacttccgataccctcaagacgctcagt
gttcatgaacacgctccagtgtttgccactggcacccaacgacatcgcgtcaagatcttc
aacattaacaacggcgaacctgtttctcactttgagccctattcaggttttcttcgcgat
cgatctgctcccatctctgtcactgctttccatcctcaccgcctgatgatagctgccgca
gcagtgcacgacacccacgtcaacatcttctcatgcctagagcccaaacattcggctgtc
aaaaccgtgaagctttgggacggaaatgcctcgacttccagtcgggcttcgacacttggt
taa

DBGET integrated database retrieval system