KEGG   Pyrenophora teres: PTT_10387Help
Entry
PTT_10387         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PTT_10387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 503 aa AA seqDB search
MAPRENSHEPSGTPAPVETGFATLTQLRVGVKAWVEKDGEKRKAEILSIQTRQGRPKFYV
HYEEFNKRLDEWIEAERIDLSREVEWPAPEKADKKKGTAVKVDKAPSKSDQKSLKRSRSK
LDREISGTPESTSSNLPGKAPRPSKAGGKENQELIVTSEVTEGTPKPEDEEMDLVDVQDA
AAAAKAMPPQDYSREDEIEKLRTSGSMTQNQTEISRVRNLEKIQMGKFEVEPWYFSPYPI
DFVDSDVVYICEFCLSYYGEVTQFERHRTKCHLLHPPGNEIYRDDYVSFFEIDGRRQRTW
CRNLCLLSKLFLDHKTLYYDVDPFLFYCMCTRDEHGCHFVGYFSKEKESAEGYNVACILT
LPQYQRKGFGKLLIDFSYLLSKREGKLGSPEKPLSDLGLLGYRAYWQEILVDILMEPGRT
EANIEDLGAATAMTTNDVLHTLQNLNMLRYSKNQHVVVLTDAVIAQRERQKAKEKLQGKR
SIDPDRLIWKPPVFSAASRTWNW
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgtgaaaactctcacgagccctctgggacgccggcaccagtggaaacgggc
tttgccacactgacgcagctgagggtcggtgtgaaagcatgggttgaaaaggatggcgag
aagcgcaaagctgaaatactgtccatacaaacacgccaaggcaggccaaagttttatgtt
cattatgaagagttcaacaaacgtctcgacgagtggatcgaggccgagcgaatcgatctc
tcgcgcgaagtagaatggcctgcgccagaaaaagcagacaaaaagaagggcactgctgtc
aaggtcgacaaagcaccgtcaaagtctgaccagaagagcttgaagcgttcacgtagcaag
ctcgatcgcgaaatctcaggaacaccagagtcgacatctagcaacttgccaggcaaagca
ccgaggccctccaaagcaggcggcaaggagaaccaagaactaatcgtcaccagcgaagtt
actgaaggtacgccaaagccggaagatgaagagatggacctggttgatgtgcaggatgcc
gctgctgctgccaaggccatgccaccccaggactattcaagagaagacgagattgagaag
ctgcgaacatccggatccatgacacagaatcagacggagatctcaagagtgcggaacctc
gaaaagatccagatgggaaaatttgaagtcgagccatggtacttttcgccctaccccatc
gactttgtcgactcggacgtagtctatatatgcgaattctgcctctcttactacggcgag
gtgacacagttcgagcgccaccgcacaaagtgtcacctcctccacccgcccggcaacgag
atctaccgcgatgattacgtatctttcttcgagattgacgggcgacggcaacgcacatgg
tgtcgcaatctctgcctactctccaagctctttctagaccacaagacgctctactatgac
gtcgatccctttctgttctactgcatgtgcacacgcgatgaacacggctgccattttgtg
ggctatttttcaaaagaaaaggaatctgcagaaggctacaatgttgcttgtattttgacc
ttgccccagtaccaacggaaaggcttcggaaaacttctcatcgacttttcctatctcctg
tccaagcgtgagggcaagctcggctctccagaaaagcccttatccgatttgggtcttctc
ggatatcgtgcgtattggcaagaaatcctcgtcgacattctcatggagccaggacgtaca
gaagccaacatcgaggatctaggagctgcaacagcaatgaccacaaacgatgttcttcat
accttgcaaaatctcaacatgctgcggtatagtaagaatcagcacgtcgttgtgctcacc
gacgccgtcatcgcacagcgtgagcgacagaaagcaaaggaaaagctgcaggggaagagg
agcattgatcccgatcggttgatttggaagccacctgtgttctctgctgcaagccgaaca
tggaactggtga

DBGET integrated database retrieval system