KEGG   Pyrenophora teres: PTT_10518Help
Entry
PTT_10518         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 374 aa AA seqDB search
MASASRNFSRALRTAAPSFRTTSTRSSARFVAPAQNAFRNQRRGYASQEDGPDMHEGNPT
GLAWGAGALLVGVGVYSLYTYKPELFGQTNTKKIFTPRFEDYQKVYDHIAKLLQDHDDYD
DGSYGPVLLRLAWHASGTYDKMTNTGGSNGATMRFAPEGDHGANAGLKAARDFLEPVKES
FPWITYSDLWILAGVCAIQEMQGPKIPYRAGRTDRDVSFCTPDGRLPDASKDRSHIRAIF
GRMGFDDRAMVALSGAHALGRCHTDRSGYDGPWTFSPTTLTNDYFKLLLEEKWQYKKWNG
PKQFEDVKTKSLMMLPTDMELVKDKSFKKYTDLYAKDNDAFFKDFSESVCTLFELGVPFQ
QPEDQRYVFKSSFD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggcctctcgaaacttttctcgcgccctgcgcaccgctgcgccctcatttcgc
accacatcgactcgctcgtctgcccgcttcgtcgctcccgcacaaaacgctttccgtaac
cagcgacgcggatacgcttcccaggaggatggcccagacatgcatgagggcaaccccact
ggtctagcatggggtgctggcgctctcctcgtcggtgttggtgtatacagtctgtacacg
tacaagccagagttgttcggtcagaccaacaccaagaaaatcttcaccccgcgcttcgag
gactaccagaaggtttacgatcatattgcgaagctgctgcaggatcacgatgattacgat
gatggcagctacggacccgtgctgcttcgcctggcatggcacgcttctggaacctacgac
aagatgaccaacacgggtggttccaacggcgccaccatgcgctttgcccccgaaggtgac
cacggcgccaacgccggtctaaaggctgcccgcgacttccttgagcccgtcaaggagtcc
ttcccctggatcacatactctgatctctggatcctcgccggcgtctgcgccattcaagag
atgcaaggtcccaagatcccctaccgcgccggccgcaccgaccgcgacgtatccttctgc
acacccgacggtcgcctcccagacgcgagcaaggaccgtagccacatccgcgccatcttc
ggccgcatgggcttcgacgaccgcgctatggttgctctgtctggtgctcacgctctgggc
cgctgccacaccgaccgctctggctacgacggcccctggaccttctctcctactaccctg
accaacgactacttcaagctgctgctcgaggagaagtggcaatacaagaagtggaatggc
cccaagcagttcgaggacgtcaaaactaagagcctcatgatgctgcctacggatatggag
cttgtcaaggacaagagtttcaaaaagtacactgatctgtatgccaaggacaacgatgct
ttcttcaaggacttttcagagtctgtttgcaccctgtttgaactcggtgtaccgttccag
cagccagaggaccagcgctacgtcttcaagagctcttttgattaa

DBGET integrated database retrieval system