KEGG   Pyrenophora teres: PTT_10620Help
Entry
PTT_10620         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pte  Pyrenophora teres
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PTT_10620
Enzymes [BR:pte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     PTT_10620
Glycosyltransferases [BR:pte01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   PTT_10620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 975 aa AA seqDB search
MANVASSNTYLGEKTSSRRSGRSKSRSPAPNGRKQQKSQQKVQGYTSEGVRDHDILNLPS
SDWSLLAMLTVVATAVRLFRIQQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLIT
LAGWLGGFDGDFDFKDIGKDYLEPKVPYVTMRMLPAICGVLTIPTMFLTLKAAGCRTTTA
ALGAGLVIFDNALVTQSRLILLDSPLIIFTALTALAWTCFMNQHEQGPVKAFKPSWWFWL
TATGVGLGATVSVKWVGLFTIAWVGSLTLLQLWVLLGDTRNVTPRLWFKHFFARVFCLIV
IPVSFYMAMFGIHFICLVNPGEGDGFMSSEFQATLNSKGMHSVPADVAYGSRVSLRHWNT
QGGYLHSHSHMYPTGSKQQQITLYPHKDENNIWILENSTLPVMPEDYNGPNLTSPKAWDN
IGPTYIENGGIIRLYHLTTDRRLHSHDVRAPVTEADWQNEVSAYGYEGFEGDANDLFRIE
IVKAKSDGAVAKQRLRTIETKFRLVHVMTGCALFSHKVKLPDWGFEQQEVTCAKQGTLPN
SIWYIEGNIHPLMVDSEVERVNYRNPGFFGKFWELQKVMWKTNAGLTESHAWDSRPPSWP
ILHRGINFWGKHNRQIYLIGNVFTWWTTTALIGLYVVIKGIAILRWQRGCHDYNNVTFKR
FDYEVGMTILGWAFHYFPFFLMARQLFLHHYLPALYFAILALCQMFDFVSYRFSVFGLRK
YPAIGQAAAVGFLAIAIAVFTVYSPLAYGNAWTKDACNSAKLFSSWDWDCNNFLDSYEAY
NIMTTEPVPSIAAPASAPPVAPAPAAPEVVPEVQPEQPKEQPKEVKEEKVMSEKPLVSAA
AQEALKDLPIVKKEERIEYRDENGRVLDDKEVAALAGKVSFKTRYETRTRVVDGQGNEIY
EGLVEAHGDAVEYGVAPPHPDAEGRNPETRDKVGTPEASDIPPTVEAAADQQKEQSIEKR
REEAQPASEAKSATK
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgtagcgtcatccaacacgtacctgggcgagaagacgtcgtctcgtcgctca
ggcagatcaaagtcacgctcaccagcaccaaatggccggaagcagcaaaagtcacaacag
aaggtccaaggctacacctctgagggagtgcgggaccatgacatcctcaatctccccagc
tcggattggtcattgttggccatgttgactgttgttgctactgctgtgcggctttttaga
atccaacagcctaccagtgtcgtattcgacgaagtccacttcggtggttttgcgtccaaa
tacatcaagggcaggttcttcatggatgtccaccctccgcttgcgaagctcctcattaca
ctggctggttggttgggcggatttgatggagactttgacttcaaagatatcggcaaagac
tacctcgaacccaaggtcccctatgtcacgatgcgcatgttgcccgccatctgtggtgtt
ctcaccattccgaccatgttccttacgctcaaggctgcgggttgccgtacgacgaccgca
gcattgggcgcgggtcttgtcatcttcgacaatgcgctcgttacccaatcccgtctaatt
cttctcgattcgccccttatcatcttcacggccctcactgcgcttgcatggacatgcttt
atgaatcaacacgaacaaggacccgtaaaggcattcaaaccgtcatggtggttctggttg
accgccactggtgtcggactcggtgcgacggtcagtgttaagtgggttggcctattcaca
atcgcatgggttggcagcttgacgctcttgcaactttgggttctactcggagacaccagg
aacgtgaccccacgtttgtggttcaagcacttcttcgcccgcgtattctgtctgatcgtc
attcccgtatctttctacatggccatgtttgggattcacttcatctgcctcgtcaaccct
ggcgagggtgatggcttcatgtcttccgagttccaggccacactgaactccaagggtatg
cattctgtgccagccgatgtcgcgtatggaagtcgcgtctctctgcgccattggaacact
caaggcggatatctccactcccacagccacatgtacccaaccggcagcaagcagcaacaa
atcaccctctacccccataaggacgagaacaacatctggatcctggagaattccacacta
cctgtcatgccagaggactacaacggaccgaatctgaccagccctaaagcttgggataac
attggacccacttatatcgagaacggcggcattatccggctctaccaccttaccaccgac
cgacgtctccactctcacgatgttcgtgcacctgttaccgaggctgactggcaaaacgag
gtttctgcatatggctatgagggctttgagggtgatgcaaacgacttgttccgcatcgaa
attgtcaaggccaagtctgacggagctgtcgctaaacagcgtcttcgtaccattgagacc
aagtttaggctcgttcatgtcatgactggatgcgcactattctcgcacaaggttaaactt
cctgattggggatttgagcagcaggaggttacatgtgctaagcaaggtacattgccaaac
agcatctggtacattgaaggcaacatacaccctttgatggtcgattccgaagtcgaaagg
gtcaactaccgcaacccaggcttttttgggaagttttgggagttgcaaaaggtcatgtgg
aagaccaacgctggtcttaccgaatcacacgcctgggactcccgccctccctcctggcct
atccttcaccgaggtatcaacttttggggcaaacacaaccgtcagatatacctcattggt
aatgttttcacctggtggacaactacagcgctcattggcctttacgtcgttatcaagggt
attgctattctccgatggcagcgcggctgccacgattacaacaacgtcactttcaagagg
ttcgactacgaggttggcatgactatcctgggatgggcattccactacttcccgttcttc
ctgatggcgcgccagctgttcttacatcactacttgcccgctctttacttcgccatcctt
gctctttgccagatgtttgactttgtgagctaccgattcagcgtctttggtttgcgaaaa
taccccgccattggtcaagcagcagctgtcggtttcctagctatcgctatcgccgtcttt
actgtctactccccacttgcctatggcaacgcatggaccaaagatgcttgcaatagtgcc
aaactcttcagctcttgggactgggactgcaacaacttccttgactcgtacgaagcctac
aacatcatgactactgagcctgtgccttccatcgcagcacctgcatcagcgcctcctgtg
gctccagcacctgctgcgccggaagtcgttcccgaggttcagcccgaacagccaaaggag
caaccgaaggaagtaaaagaagagaaggtcatgtctgagaagcctcttgtatcagcagct
gcgcaggaagccttgaaagacttgcccattgtgaagaaagaggagcgcattgagtaccgc
gacgaaaacggtcgtgttcttgacgacaaggaagtggctgcgctcgctggtaaggtcagc
ttcaagacgcgttacgagactcgcacccgggtcgtcgatggacaaggcaacgagatctat
gagggtctggttgaagctcatggcgatgcggtagagtacggtgttgcgccgcctcacccc
gacgccgaaggccggaacccggagactcgggacaaggttggaactcctgaagccagcgac
attccgcctactgttgaggctgcggcagaccaacagaaggaacagagcattgagaagcgt
cgagaggaagctcagcctgctagcgaggcaaagtctgcgaccaagtag

DBGET integrated database retrieval system