KEGG   Pyrenophora teres: PTT_10831Help
Entry
PTT_10831         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pte  Pyrenophora teres
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pte00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 354 aa AA seqDB search
MAYEKELEIALLAVQRASILTKSVYSSHSKGTLSKSDSSPVTIGDFGAQALIIASIKHAF
PEDEIVGEEDADDLRKNDSLRDLVWDLVQAAKLDDSSAEDKIGGPIKSADAMLSAIDAGN
SQGGRKGRIWALDPIDGTKGFLRGGQYAVCLGLLVDGIPTVGVIGCPNLPVDDQAPLDAT
TGQDADDKEGKGVLFGAVKGQGATSRPLSKGGLQTPKPITMKPLPDVSQATFCESVEAGH
SSQGDNAAIASKLGITKPSVRMDSQAKYGSIARGAGDLYLRLPVSKTYQEKIWDHAAGVV
LVQEAGGEVTDAYGKPLDFGIGRTLKENKGVVAAPKDAFAQVIAVVKEVLSAKE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgaaaaggaactggagattgctctcctcgccgtgcagcgcgcctccattctc
acaaagtccgtctactcgagccactccaaaggcaccctatccaagagcgactcgtcgccc
gtcacaattggcgactttggcgcccaagccctaatcatcgcatcgataaagcacgccttc
ccggaggatgagattgtcggcgaagaggatgctgatgacttgcgcaaaaacgactcgctc
cgcgacctagtctgggacctggtacaagcagcgaagcttgacgacagctcagcagaggac
aagattggtggacccatcaagagcgcagatgccatgctatccgcaattgatgccggcaac
agccagggaggcaggaagggcagaatctgggcactcgaccccattgacggcacaaagggt
ttcttgcgaggcggacagtatgccgtctgcctgggcctgctagtcgacggcatacccacc
gtcggcgtcatcggatgccccaaccttcccgtagacgaccaagcacccttggacgcgacc
actggccaagacgcagacgacaaggaaggcaagggcgtcctcttcggcgccgtaaaagga
caaggcgcaacaagccggcccctaagcaaaggtggcctccaaacccccaagcccatcacc
atgaagcccctccccgacgtctcccaagccaccttttgcgaatccgtagaagcaggccac
tcctcgcaaggcgacaatgccgccattgcctccaaactcggcatcaccaagccctcagtc
cgcatggactcgcaggcaaaatacggctccattgcccgtggcgcaggcgacctctacctc
cgtctcccagtcagcaagacataccaagagaagatttgggatcacgccgccggtgtcgtt
ctcgtccaggaggcgggcggtgaggtcacggatgcatatggcaagccgcttgactttggc
attggcaggacgctcaaggagaacaagggagtggttgctgcgccaaaggatgcatttgca
caggtcattgctgttgtcaaggaggtgttgagcgccaaagagtag

DBGET integrated database retrieval system