KEGG   Pyrenophora teres: PTT_10964Help
Entry
PTT_10964         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
pte  Pyrenophora teres
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pte04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 355 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTSQAVAIKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
ICSENTLRFVQSLPKRERQPLSNKFKNAEPQAVDLLENMLVFDPKKRVRAEQALAHPYLA
PYHDPTDEPIAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVDAAAQEQENNGS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatttgtacgcgcccagatttttggcaccacctttgagattacgagcaggtac
acagatctgcagcccgtaggcatgggcgcattcggtcttgtctgctcagcaaaggaccag
ctcacgagccaggcggtggcgatcaagaagatcatgaagccctttagcacccccgtcctg
tccaagcggacataccgagagttgaagcttctgaagcatcttaggcacgagaatattatc
agcttgagcgacatcttcatctctcccctcgaagacatctacttcgtcaccgagctcctc
ggaaccgaccttcaccgcctgctgacctccagaccgctggagaagcagttcatccaatac
ttcctctaccagatcttgcgtggtctgaaatacgtccactcggctggtgtcgtgcatcgt
gacctgaagcccagcaacatcctcgtcaacgagaactgcgatctcaagatctgcgacttc
ggtctcgctcgtatacaagacccccagatgacgggatacgtctcgacccgatactaccga
gcgccagagatcatgctcacatggcaaaagtacgatgtcgaggtggatatctggagtgca
ggatgtatcttcgccgagatgctcgagggcaagccgctattccctggaaaagatcacgtc
aaccaattctccattattacggagctgttgggtactcccccggatgacgtgatccaaacc
atttgcagtgaaaacacactgcgattcgttcagtcactccccaagcgcgagcgacaaccc
ctgtccaacaagttcaagaacgccgagccccaggccgtcgatctcctagagaacatgctg
gtctttgaccccaagaagcgcgtacgagcggagcaggctctcgcacacccatacctagcc
ccataccacgacccgactgatgagccgatcgcggaggagaagtttgactggtcgttcaac
gatgctgacttgcccgtcgacacatggaagattatgatgtactcggagatcttggactac
cacaacgtcgatgcggcggcacaggaacaggagaacaacggcagctaa

DBGET integrated database retrieval system