KEGG   Pyrenophora teres: PTT_11027Help
Entry
PTT_11027         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pte  Pyrenophora teres
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pte04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 984 aa AA seqDB search
MSAAAPQPPSGHLPGNTMNGFPNGAQSAGSDGSSRGGGGPYPPIAEIVGSALDTVDSLRN
NSIRHLLAHAKGHFNSAKTMLDGRVPAGAYWEYLVAYQIVVDVIPSHRDYYDKINNSRGS
AHRDFNELMRDIKSSEERFMRVKEIIKNDNKRNGASHHSRSISVPSSQHNTPTSSRPTSP
HSSNMPRRDDELMLPEVPTTMPNGRASPADSLDSSRRKPPVQPKPQSLHGRAVRQSLSSI
PGVNDLAQRFANLRSTPPVTTTSAPPSQDLSVKMPSPADYHTTNRLVGPRGIPSQPSSML
PPSLPMLPLDTAFAASLPKEPSPTYSPARNIPGPSSINPPRSTPRSMNGTGGRNNSIAAS
SLSNQAPNVNGAPDSYFPAQQQVRDATGRTRAVNKPVELQIDASMLYDYYRMYNVLTIDV
RDRAQFDAGHVYVRNIMCIEPLTMREGDSAEQLLDRLVISPDEEQAMFDRRNEFDVVVYY
DDSTKNIDFMHRHDRNESERALKQLFDTLYEFNADKPLRRPPVLLKGGLDAWIDLVGPQA
LKMSTTAAFVAAGATRNQTTRRSSVATIQLAKNNQRRSRREYVPMDHEEEELWLEEARKG
RAAVEVPPSSEDQEEEQNTPFYRSTEDFLRRYPDVEAEQSMRDNWKGTKGILPEAYATLL
SNLYKGDVTSVRPSTFRRICGHFNSQWGIDEQQDAKEFLEFVLDYMHEDMNLTWNKPPLK
PLTDQEELTRERFPRQYSAMIEWRRYQHRDMSVIGGMFAGQHASQLTCQTCGVTSTTYEA
FWSISVEIPREGQCDLRECLQSYCAPERLAGDELWRCPRCKKDREAMKKITITRAPDTLV
IHFKRFSASRTESARKVRTPVNFPLQRLDMSPFIEPPMTPEQEAYVAQTARDGPAQLAGV
KSDPTMNGPFVYNAYAVIWHIGATLGSGHYVAFVKDKSRGCWRSFNDDKIQDFDPGNLPA
HNRLQNEKAYIVFYERERVAGGAF
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcggctcctcagccgccctcaggacatctgcccggcaacacgatgaacggc
ttccccaatggcgcacagagtgctggatcagacggcagctccaggggcggtggaggcccg
tatccgcccatcgccgagattgtaggctctgccctggatacggtagactcgctcaggaac
aattcgatccgtcaccttctcgcacacgcaaaaggtcacttcaattcggccaagacgatg
ctcgacggccgtgtgccagccggcgcatactgggaatacctggttgcctaccaaattgtc
gtcgacgtgataccctcccatcgtgactactatgacaagatcaacaacagtcggggttcg
gcacatcgcgacttcaacgagctcatgcgcgacatcaaatcgagcgaagagaggttcatg
cgcgtcaaggaaataatcaaaaacgacaacaaaagaaatggggcgtcgcatcacagtagg
agcatatcggtaccttcatcacaacacaacacacctacgtcctcgagaccaacgtcgcct
cacagttccaacatgcccaggagggacgacgaattgatgctgcctgaagtcccaactacc
atgcccaacggtcgcgcttcacctgctgattctctagattcttcacggagaaaacccccc
gtacaaccgaaaccgcaatcgttgcatggtcgcgctgtccgccagagcttgtcgtcaata
cccggcgtaaacgatctcgctcagcgcttcgccaatctgagatccacccctccagtcact
acgacctcggcaccacccagtcaagatctctcggtcaagatgccctcgccagcagactac
cacaccacaaaccgactcgtgggaccgcgtggcatcccgtcgcagccttcgtccatgctt
ccgccttctctgccgatgctgccgctggacacggcctttgccgcttctttgcccaaggaa
ccgagtccaacctatagtccggcacgaaacataccaggcccttccagcattaatccgcct
cggagtacgcccaggagtatgaatggcacgggaggtcgtaataattccatagccgcatct
agtctgtccaatcaagcgccaaacgtgaatggcgcaccagactcgtatttcccggcccag
caacaggtacgcgacgcgacaggaaggacaagagctgttaataagccggttgaattgcaa
atcgacgccagcatgctctacgactactaccgcatgtacaatgtactcaccattgacgtg
cgcgacagagcccagtttgacgcaggacacgtatatgtgcgcaacatcatgtgcatagag
ccgttgacgatgcgcgagggtgattctgctgaacagcttctggatcgcttagtgatatct
ccagatgaagagcaggccatgtttgacagacggaacgaatttgacgtcgtggtatattac
gatgactccaccaaaaacatcgacttcatgcacaggcatgaccggaacgagagcgagcgt
gcgttgaagcaacttttcgacacactatacgagtttaatgccgacaaaccgttgcgacga
cctcctgttctgctcaaaggtggtcttgatgcctggattgatttggtaggcccacaggca
ttgaaaatgtctaccactgctgcgtttgtcgcggctggcgctactagaaatcagacaacc
cgacgttcatctgtggccacgatacaacttgccaagaacaatcaaagaaggtcaagacgc
gagtacgttcccatggaccacgaggaagaggaactttggttggaagaagcccgaaaaggc
cgtgctgcagtcgaagtcccaccaagtagtgaagaccaagaagaagagcagaataccccc
ttttatcgatccaccgaagactttctgcgtcgctaccccgatgtcgaggccgagcaatcg
atgcgggacaactggaaaggaacaaagggcatcttaccggaggcttacgcgacgctcctc
tccaacctgtacaaaggcgatgtcacatctgtccgtcccagcactttcaggcgtatttgc
ggccacttcaactcacaatggggcattgacgaacagcaagatgccaaggagttccttgag
tttgttctggattatatgcatgaggacatgaatttgacatggaacaaacccccgctcaag
cctcttacagaccaggaagagttgacacgcgagaggtttccacgccagtactcggctatg
atcgagtggcggcgttaccaacatcgtgatatgtccgtcattggtggcatgtttgctggt
caacacgcttcccaactcacatgccaaacatgtggagtcaccagcacgacatacgaggca
ttttggagcataagtgttgaaattcctcgcgaaggccagtgcgatctgcgcgaatgtcta
cagtcgtactgtgcacctgaacgcctagcaggagatgagctgtggcgttgcccacgttgc
aagaaagatcgcgaggccatgaagaagattaccatcactcgcgcacccgacacgctcgtt
atacactttaagcgattcagtgcctcccgaactgaaagcgctcgaaaggttcggacgcct
gtaaacttcccgttacagcggctggatatgtcgcctttcatcgaaccacccatgacgccg
gagcaagaagcgtacgtagcgcagacagctcgtgatgggccggcgcaactggctggagtc
aagtcggaccctacgatgaatgggccctttgtttacaacgcatacgctgtaatatggcat
atcggtgccacactcggcagcggtcactatgttgcttttgtgaaggacaaatcgcgaggg
tgctggagatctttcaatgatgacaagatccaagactttgatcctggaaaccttccagcg
cacaatcgattgcaaaacgaaaaggcgtatattgtgttttatgagagggaaagggtcgct
ggcggggctttctag

DBGET integrated database retrieval system