KEGG   Pyrenophora teres: PTT_11027Help
Entry
PTT_11027         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pte  Pyrenophora teres
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pte00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PTT_11027
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PTT_11027
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PTT_11027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 984 aa AA seqDB search
MSAAAPQPPSGHLPGNTMNGFPNGAQSAGSDGSSRGGGGPYPPIAEIVGSALDTVDSLRN
NSIRHLLAHAKGHFNSAKTMLDGRVPAGAYWEYLVAYQIVVDVIPSHRDYYDKINNSRGS
AHRDFNELMRDIKSSEERFMRVKEIIKNDNKRNGASHHSRSISVPSSQHNTPTSSRPTSP
HSSNMPRRDDELMLPEVPTTMPNGRASPADSLDSSRRKPPVQPKPQSLHGRAVRQSLSSI
PGVNDLAQRFANLRSTPPVTTTSAPPSQDLSVKMPSPADYHTTNRLVGPRGIPSQPSSML
PPSLPMLPLDTAFAASLPKEPSPTYSPARNIPGPSSINPPRSTPRSMNGTGGRNNSIAAS
SLSNQAPNVNGAPDSYFPAQQQVRDATGRTRAVNKPVELQIDASMLYDYYRMYNVLTIDV
RDRAQFDAGHVYVRNIMCIEPLTMREGDSAEQLLDRLVISPDEEQAMFDRRNEFDVVVYY
DDSTKNIDFMHRHDRNESERALKQLFDTLYEFNADKPLRRPPVLLKGGLDAWIDLVGPQA
LKMSTTAAFVAAGATRNQTTRRSSVATIQLAKNNQRRSRREYVPMDHEEEELWLEEARKG
RAAVEVPPSSEDQEEEQNTPFYRSTEDFLRRYPDVEAEQSMRDNWKGTKGILPEAYATLL
SNLYKGDVTSVRPSTFRRICGHFNSQWGIDEQQDAKEFLEFVLDYMHEDMNLTWNKPPLK
PLTDQEELTRERFPRQYSAMIEWRRYQHRDMSVIGGMFAGQHASQLTCQTCGVTSTTYEA
FWSISVEIPREGQCDLRECLQSYCAPERLAGDELWRCPRCKKDREAMKKITITRAPDTLV
IHFKRFSASRTESARKVRTPVNFPLQRLDMSPFIEPPMTPEQEAYVAQTARDGPAQLAGV
KSDPTMNGPFVYNAYAVIWHIGATLGSGHYVAFVKDKSRGCWRSFNDDKIQDFDPGNLPA
HNRLQNEKAYIVFYERERVAGGAF
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcggctcctcagccgccctcaggacatctgcccggcaacacgatgaacggc
ttccccaatggcgcacagagtgctggatcagacggcagctccaggggcggtggaggcccg
tatccgcccatcgccgagattgtaggctctgccctggatacggtagactcgctcaggaac
aattcgatccgtcaccttctcgcacacgcaaaaggtcacttcaattcggccaagacgatg
ctcgacggccgtgtgccagccggcgcatactgggaatacctggttgcctaccaaattgtc
gtcgacgtgataccctcccatcgtgactactatgacaagatcaacaacagtcggggttcg
gcacatcgcgacttcaacgagctcatgcgcgacatcaaatcgagcgaagagaggttcatg
cgcgtcaaggaaataatcaaaaacgacaacaaaagaaatggggcgtcgcatcacagtagg
agcatatcggtaccttcatcacaacacaacacacctacgtcctcgagaccaacgtcgcct
cacagttccaacatgcccaggagggacgacgaattgatgctgcctgaagtcccaactacc
atgcccaacggtcgcgcttcacctgctgattctctagattcttcacggagaaaacccccc
gtacaaccgaaaccgcaatcgttgcatggtcgcgctgtccgccagagcttgtcgtcaata
cccggcgtaaacgatctcgctcagcgcttcgccaatctgagatccacccctccagtcact
acgacctcggcaccacccagtcaagatctctcggtcaagatgccctcgccagcagactac
cacaccacaaaccgactcgtgggaccgcgtggcatcccgtcgcagccttcgtccatgctt
ccgccttctctgccgatgctgccgctggacacggcctttgccgcttctttgcccaaggaa
ccgagtccaacctatagtccggcacgaaacataccaggcccttccagcattaatccgcct
cggagtacgcccaggagtatgaatggcacgggaggtcgtaataattccatagccgcatct
agtctgtccaatcaagcgccaaacgtgaatggcgcaccagactcgtatttcccggcccag
caacaggtacgcgacgcgacaggaaggacaagagctgttaataagccggttgaattgcaa
atcgacgccagcatgctctacgactactaccgcatgtacaatgtactcaccattgacgtg
cgcgacagagcccagtttgacgcaggacacgtatatgtgcgcaacatcatgtgcatagag
ccgttgacgatgcgcgagggtgattctgctgaacagcttctggatcgcttagtgatatct
ccagatgaagagcaggccatgtttgacagacggaacgaatttgacgtcgtggtatattac
gatgactccaccaaaaacatcgacttcatgcacaggcatgaccggaacgagagcgagcgt
gcgttgaagcaacttttcgacacactatacgagtttaatgccgacaaaccgttgcgacga
cctcctgttctgctcaaaggtggtcttgatgcctggattgatttggtaggcccacaggca
ttgaaaatgtctaccactgctgcgtttgtcgcggctggcgctactagaaatcagacaacc
cgacgttcatctgtggccacgatacaacttgccaagaacaatcaaagaaggtcaagacgc
gagtacgttcccatggaccacgaggaagaggaactttggttggaagaagcccgaaaaggc
cgtgctgcagtcgaagtcccaccaagtagtgaagaccaagaagaagagcagaataccccc
ttttatcgatccaccgaagactttctgcgtcgctaccccgatgtcgaggccgagcaatcg
atgcgggacaactggaaaggaacaaagggcatcttaccggaggcttacgcgacgctcctc
tccaacctgtacaaaggcgatgtcacatctgtccgtcccagcactttcaggcgtatttgc
ggccacttcaactcacaatggggcattgacgaacagcaagatgccaaggagttccttgag
tttgttctggattatatgcatgaggacatgaatttgacatggaacaaacccccgctcaag
cctcttacagaccaggaagagttgacacgcgagaggtttccacgccagtactcggctatg
atcgagtggcggcgttaccaacatcgtgatatgtccgtcattggtggcatgtttgctggt
caacacgcttcccaactcacatgccaaacatgtggagtcaccagcacgacatacgaggca
ttttggagcataagtgttgaaattcctcgcgaaggccagtgcgatctgcgcgaatgtcta
cagtcgtactgtgcacctgaacgcctagcaggagatgagctgtggcgttgcccacgttgc
aagaaagatcgcgaggccatgaagaagattaccatcactcgcgcacccgacacgctcgtt
atacactttaagcgattcagtgcctcccgaactgaaagcgctcgaaaggttcggacgcct
gtaaacttcccgttacagcggctggatatgtcgcctttcatcgaaccacccatgacgccg
gagcaagaagcgtacgtagcgcagacagctcgtgatgggccggcgcaactggctggagtc
aagtcggaccctacgatgaatgggccctttgtttacaacgcatacgctgtaatatggcat
atcggtgccacactcggcagcggtcactatgttgcttttgtgaaggacaaatcgcgaggg
tgctggagatctttcaatgatgacaagatccaagactttgatcctggaaaccttccagcg
cacaatcgattgcaaaacgaaaaggcgtatattgtgttttatgagagggaaagggtcgct
ggcggggctttctag

DBGET integrated database retrieval system