KEGG   Pyrenophora teres: PTT_11156Help
Entry
PTT_11156         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pte  Pyrenophora teres
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pte03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 424 aa AA seqDB search
MPEIAEVARVVHFLKKHIVGKTINIVTAQDDPIIYGKVGTSASAFQKAITGKKVVDARQQ
GKYFWLVLDSQPHPLFHLGMAGWVEYKNEETGYYRSTKPEKTEWPPKFWKFVLQMKEEPE
NEMAFVDARRLARIRLVDAAAEDMRKTTPLKENGPDPILDKSILTVDWLGKKLRSKKVPV
KALLLDQANISGIGNWVGDEVMYQAKLHPEQYSNTFSDEQIKALHEAIMYVCDTAVAANG
DSDLFPEHWLMKHRWGKGKKEASKLPTGEKITFLKVGGRTSAIVPSVQKKTAAVAGDVSE
SAADEDVEEEAKPKKTNKRTAKAAKEEDDEVEEKAEPKPKRGRKNTKGEVKVETEDAAVD
ELPARPKRQSKKVKEETEEGGSDEAEEVKPVKKQSTAKASKAKINKENQSEITTEKRRSG
RLSK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagattgcagaagtagcacgcgttgtgcactttctgaagaagcatatcgtcgga
aagaccatcaacatcgtgacagcgcaggacgatcctataatatatggaaaagtcggtacc
tctgcctcggctttccaaaaagccatcactggcaagaaagtagtggacgcgcgacaacaa
ggcaaatacttctggctcgtcttggactctcaaccacatcctctcttccatcttggaatg
gcaggatgggttgaatataagaatgaggagactggatactatcgctcaaccaagcctgag
aagactgagtggcctcccaagttctggaagtttgttttgcagatgaaagaagaacccgag
aatgagatggccttcgtggacgcaaggcgattagcccgtatccgactggtggatgctgct
gcagaagacatgaggaagacgacaccgttgaaagaaaatggccctgaccccatcctggac
aaatccatcctaactgtagattggttgggtaagaagttgaggagtaagaaggtgcctgtc
aaggccctgttgctcgatcaagccaacatatccggtatagggaactgggttggcgatgag
gtcatgtaccaggccaaactgcaccctgagcaatatagcaacacattcagcgacgagcag
atcaaggcactccacgaggcaatcatgtacgtctgcgacactgcggtagcagccaatgga
gattcagatctttttcccgagcactggctcatgaagcatcgttggggtaaagggaagaag
gaggcaagcaagctgccaaccggtgagaagattacgtttctcaaagttggcggacgtaca
tcggctattgttccgagtgtccagaagaaaacagcggctgtggctggcgatgtctctgag
agcgctgcagacgaagacgttgaagaagaggcgaagcccaagaagaccaacaagaggacc
gcaaaggcagcaaaggaggaggacgatgaagtcgaggagaaggcagagcccaagcccaag
cgaggccgcaagaacaccaagggagaggtcaaggtggagactgaagacgccgctgttgac
gaattaccagcaaggccgaaacgtcagagcaagaaagtcaaggaagagaccgaagaagga
ggtagcgatgaagctgaggaggttaagccagtgaagaagcaaagcacggcgaaggctagt
aaggcaaaaattaacaaagagaaccaaagcgagattactacagaaaagcggcggtccgga
cgtctgtcgaagtaa

DBGET integrated database retrieval system