KEGG   Pyrenophora teres: PTT_11156Help
Entry
PTT_11156         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pte  Pyrenophora teres
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PTT_11156
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PTT_11156
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PTT_11156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 424 aa AA seqDB search
MPEIAEVARVVHFLKKHIVGKTINIVTAQDDPIIYGKVGTSASAFQKAITGKKVVDARQQ
GKYFWLVLDSQPHPLFHLGMAGWVEYKNEETGYYRSTKPEKTEWPPKFWKFVLQMKEEPE
NEMAFVDARRLARIRLVDAAAEDMRKTTPLKENGPDPILDKSILTVDWLGKKLRSKKVPV
KALLLDQANISGIGNWVGDEVMYQAKLHPEQYSNTFSDEQIKALHEAIMYVCDTAVAANG
DSDLFPEHWLMKHRWGKGKKEASKLPTGEKITFLKVGGRTSAIVPSVQKKTAAVAGDVSE
SAADEDVEEEAKPKKTNKRTAKAAKEEDDEVEEKAEPKPKRGRKNTKGEVKVETEDAAVD
ELPARPKRQSKKVKEETEEGGSDEAEEVKPVKKQSTAKASKAKINKENQSEITTEKRRSG
RLSK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagattgcagaagtagcacgcgttgtgcactttctgaagaagcatatcgtcgga
aagaccatcaacatcgtgacagcgcaggacgatcctataatatatggaaaagtcggtacc
tctgcctcggctttccaaaaagccatcactggcaagaaagtagtggacgcgcgacaacaa
ggcaaatacttctggctcgtcttggactctcaaccacatcctctcttccatcttggaatg
gcaggatgggttgaatataagaatgaggagactggatactatcgctcaaccaagcctgag
aagactgagtggcctcccaagttctggaagtttgttttgcagatgaaagaagaacccgag
aatgagatggccttcgtggacgcaaggcgattagcccgtatccgactggtggatgctgct
gcagaagacatgaggaagacgacaccgttgaaagaaaatggccctgaccccatcctggac
aaatccatcctaactgtagattggttgggtaagaagttgaggagtaagaaggtgcctgtc
aaggccctgttgctcgatcaagccaacatatccggtatagggaactgggttggcgatgag
gtcatgtaccaggccaaactgcaccctgagcaatatagcaacacattcagcgacgagcag
atcaaggcactccacgaggcaatcatgtacgtctgcgacactgcggtagcagccaatgga
gattcagatctttttcccgagcactggctcatgaagcatcgttggggtaaagggaagaag
gaggcaagcaagctgccaaccggtgagaagattacgtttctcaaagttggcggacgtaca
tcggctattgttccgagtgtccagaagaaaacagcggctgtggctggcgatgtctctgag
agcgctgcagacgaagacgttgaagaagaggcgaagcccaagaagaccaacaagaggacc
gcaaaggcagcaaaggaggaggacgatgaagtcgaggagaaggcagagcccaagcccaag
cgaggccgcaagaacaccaagggagaggtcaaggtggagactgaagacgccgctgttgac
gaattaccagcaaggccgaaacgtcagagcaagaaagtcaaggaagagaccgaagaagga
ggtagcgatgaagctgaggaggttaagccagtgaagaagcaaagcacggcgaaggctagt
aaggcaaaaattaacaaagagaaccaaagcgagattactacagaaaagcggcggtccgga
cgtctgtcgaagtaa

DBGET integrated database retrieval system