KEGG   Pyrenophora teres: PTT_11516Help
Entry
PTT_11516         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PTT_11516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 512 aa AA seqDB search
MDLNLDDWVTNSNECFDINIYRTTNKNGPERLFDAFHPSYTYTVIEENETIAGYKNPSIQ
LDFRANDMKPQLKISFDQQLDLKKISPDLNQIDLSPELFREYLPETINEAAAPAPAGWKP
PGERQSSFSLHGKQYEIWKASMTDPEARRIWINMRLLVMLFIEGATIDGLDDEETLDRWS
LYLMYDVTPPSQQDVSPYTLAGFSTSYRAWIFPTFEIARATKQLPSPAASVSGDAEKYTP
PRLSQDPDTFLFTDKLDLLQTPSRERISQFLVLPPYQGRLLGTRLYDHIFQDLAMKPFIY
EIPVEDPSEAFDAMRDYSDITYLRTLPAFQELSIASNIPPESLRKDSPIPRDQILGNGKD
LEQLRKETKIVSRQFYRMVELHLLSTIPPNNRSRSRITRKAKSSNENDRRYYFWRLALKH
RIYSQNADALDQMEDTAERVEKLESAVDSQQEEFEERLEGLEKRQSLAADDAAVPTGTRS
KRKRAVVLEDDEDDEWEDMDEESEGGTKRRRP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaatctggacgattgggtcaccaattcaaacgagtgcttcgacatcaacatc
taccgtacgacgaacaaaaatggaccggaacgccttttcgatgccttccaccccagctac
acgtacacggtcatcgaggagaatgagacgattgctggctacaagaaccccagcatccag
ctcgacttccgcgcaaacgacatgaagccccagctgaagatctcgtttgaccagcaactg
gacctcaagaaaatctccccagacctgaaccagatcgacctgtcgcccgagctgtttcgc
gaatatctcccagagacgatcaacgaagctgctgcaccggctcctgcaggctggaagccg
cctggtgaacgccagagctctttcagccttcatggaaagcaatacgagatatggaaggcc
tctatgacggaccctgaggcaaggcgcatctggataaacatgaggttactggtcatgttg
ttcatcgagggcgcaacaatcgacggcctggatgacgaggagacgttggaccgctggtcg
ctatacctgatgtacgatgtaacgcctccctcccaacaggatgtatcaccgtatacactg
gctggcttctccacatcctaccgcgcttggatattccccaccttcgagattgcgcgtgcc
acaaagcagctgccatcaccagccgctagcgtcagtggcgatgctgaaaagtatacgccg
ccacgtctgtcacaggaccccgacacctttctctttaccgataaactagatctcctccag
acgccatcacgtgagcgcatctcgcaattcctcgtcctcccaccgtaccaaggcagattg
ctcggaacccgtttgtatgaccatatcttccaggatctggcgatgaagcccttcatctac
gaaatcccagtggaagatcccagtgaggccttcgatgccatgcgcgattacagcgacatt
acttatctccgcactctccctgccttccaggaactatcaatcgcttcgaacattcctcca
gagtcgctaaggaaggattctcccattccgcgcgaccagatcctcggcaatggaaaagat
ctggaacaactgcggaaagagaccaagatcgtgagtaggcagttctacaggatggttgag
ctgcatctcttgtcaacaatcccgcccaacaaccgcagtcgatcacgaatcacgcgcaaa
gcaaagtcgagcaacgaaaacgaccgccgatactacttctggcgcctggccctcaaacac
cgtatttacagtcagaacgcagatgcgctagaccagatggaggatacggccgagagggtc
gagaagctagaatctgctgtcgacagtcaacaagaggagtttgaggagcgtctggaaggc
ttggagaagcgtcagagtttggcagctgatgacgctgccgtccccaccggcacaagaagt
aagaggaagcgcgctgtagtgctcgaggacgatgaggatgacgaatgggaggatatggat
gaggagtcagagggaggaacgaagaggagaagaccttga

DBGET integrated database retrieval system