KEGG   Pyrenophora teres: PTT_11689Help
Entry
PTT_11689         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
pte  Pyrenophora teres
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PTT_11689
Enzymes [BR:pte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PTT_11689
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PTT_11689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 281 aa AA seqDB search
MAAVQTLPTPVGGTSTYFDTDAIVDGSAPKVANSAGFFNVAVAANHKEGAEELALLKYVY
SRPDLEKLRGNPDAVCNAIDDFAATIPRGLMTIGAEKRAFITEMLATAEPAPTLFLEFGS
YVGYSAICLASAMVARAGPGQRVRYVSFEKNPIIAAVAASLADLAGLRDVISINVGPAGE
SLIRLVKEGVVTKGTVDFMLLDHWKDFYISDLQLCEKASLLRPGSVVLADNIIFPGAPEY
LAYVQAGKAEVSPDGFSYATKTADFILPFGGPDQLAISTVS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagttcagactcttcctacccccgtaggaggcacttcgacatacttcgacacc
gatgccattgtcgatggttcagcgcccaaagtggcgaatagcgctggtttcttcaatgtc
gcagtcgcagccaatcataaagaaggtgccgaagagcttgcacttctgaaatacgtatac
agccggccggacctagagaagctacgtggaaacccagatgcagtctgcaacgccattgac
gactttgcggccacgattccacgagggctgatgaccattggagcggaaaagcgtgccttc
atcacagaaatgctggctactgctgagcctgcgccgactctgttcctcgaattcggctct
tatgttggatactccgccatctgtcttgccagcgccatggtagcacgagcgggtcccggg
cagcgcgttcgctatgtctcatttgagaagaatcccatcatcgccgccgtcgccgcaagc
cttgcagatctggctggtctgcgggatgttatcagtatcaatgtcggcccagctggcgag
tcgttgatacgtctggttaaagagggtgtagtgacaaagggcactgtcgactttatgctc
ttggaccactggaaggacttttacatttctgatctgcagctgtgtgagaaagcatcccta
ctcaggccaggttcggtcgtcttagctgataatatcatctttcccggggccccagagtat
ctcgcctatgtacaggcgggtaaggcagaagtgtcgcccgatggctttagctatgcaaca
aagactgctgattttatccttccttttggaggcccagatcaactggccatctctactgtt
tcgtaa

DBGET integrated database retrieval system