KEGG   Pyrenophora teres: PTT_11709Help
Entry
PTT_11709         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pte  Pyrenophora teres
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PTT_11709
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PTT_11709
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PTT_11709
Protein phosphatases and associated proteins [BR:pte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PTT_11709
Transcription machinery [BR:pte03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PTT_11709
Spliceosome [BR:pte03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PTT_11709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 321 aa AA seqDB search
MAENEVDLDSIIDRLLEVRGSRPGKQVQLLETEIRFLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVPNLGSGRLASPRTKKT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaacgaggtggatttggactctatcatagaccgcctgctcgaggtccgcggc
agcaggcctggcaagcaggtgcagctgctggaaactgagatccgcttcctatgcaccaag
gcgcgcgaaatcttcatctcacagcccattctgctcgagcttgaggcgcccatcaagatt
tgcggagatatccacggccagtactacgaccttttgcggctgttcgagtatggtggcttt
cctccagaggccaactatctctttctaggcgactacgtcgaccgtggcaagcagtcgctc
gagaccatatgcctactcctcgcgtacaagatcaagtaccccgagaacttcttcgtcctt
cgcggcaaccacgagtgcgcctcgatcaaccgcatctacggattctacgacgagtgcaaa
cgaagatacaacatcaagctgtggaagacgtttaccgactgcttcaactgcttgcccatc
gccgctatcatcgacgaaaagatcttcaccatgcacggcggtctgagcccggatctgaac
tcgatggagcaaatcaggcgtgttatgcgaccgaccgatattcctgattgtggtcttctc
tgcgatttgctatggtctgacccagataaggatattactggctggagcgagaatgacaga
ggtgtgagctttacattcggacccgatgtggtgtcccgcttcttgcaaaagcatgacatg
gatcttatctgccgtgcgcatcaagttgtcgaagatggctacgagttcttttccaagcgc
caactcgtgacactcttcagtgcgcccaattattgtggagagttcgacaacgcaggagcc
atgatgagcgtggatgaaagtctactgtgctctttccagatcctgaagcctgccgagaag
aaacaaaagtacgtccctaaccttggcagcggtagactagcctctcctcgcaccaagaag
acctag

  All links  
No link information was found.   
DBGET integrated database retrieval system