KEGG   Pyrenophora teres: PTT_11744Help
Entry
PTT_11744         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pte  Pyrenophora teres
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PTT_11744
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PTT_11744
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTT_11744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 551 aa AA seqDB search
MATQDISARGSEPQPVPKEEIQDEPTGHLDEGKLRQFFIGSIDQGTTSTRFIIFDGLGEP
VAQHQIEFTQKYPQSGWHEHDPKEIITSVEQCIDRATNIFLDNGHDIEDIKAIGITNQRE
TTVLWDTNTGEPLCNAIAWPDTRTKGLVRELKGRPGADELLNICGLPLSTYPSSVKLRWM
LDHDENVRKAYDEGRLSFGTIDTWILYNLNGGKEAGIHVTDSTNASRTMFVNLHTVQYDD
KLLDFFGIDRNKIKLPKIVPSSSPDAFGRLRSGILEGVRIAGCLGDQSSALVGQQGFTPG
SAKNTYGTGCFLLYNVGEKPVISTHGLLATIAYDFGGKRKPVYALEGSIAVAGSGVKFLM
NNMGFITHSHKISDLAASVEDNGGCVFVTAFSGLFAPYWIDDAKGTIFGITQFTERGHIA
RATLEATCFQTRAILDAMELDSGHKLNMLAVDGGMSNSNLCMQTQANIIGIPVDRPAMRE
TTALGAAIAAGFAVGVWKEFDELKEINQKDRMVFKPNIGKEEGEKMFKKWGRAVEMCRGW
LDAGEANGEFS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctacacaagacatctctgcccgtggctcagaaccgcaaccagtacccaaggaagag
atccaggatgagcccacggggcacctagacgaagggaagctaagacagttcttcattgga
tctatagatcaaggaaccacaagtactcgcttcatcatctttgacggccttggtgagccc
gtggcccaacatcagattgagttcacccagaagtatccccagtctgggtggcacgaacac
gatcccaaagagattattacctcggtagagcaatgcatcgatagagcgacgaacatcttc
ctagacaatggccacgatatcgaagacatcaaggccattggtatcaccaaccagcgtgag
acgacagtcctctgggataccaacaccggagaacccctctgtaatgcaattgcttggcca
gataccaggaccaagggattggtccgtgagctgaaaggacggccaggcgccgatgagctg
ctaaacatatgtgggctgccgctgtcgacgtacccatcatcggtgaagcttcgatggatg
cttgaccatgatgaaaacgtcaggaaggcgtacgacgaaggtcgcctatcctttggcaca
atcgatacgtggatattatacaacctgaatggtggaaaggaagccgggattcatgtaacc
gactccactaacgcatcaagaaccatgtttgtgaatctgcacaccgttcagtacgatgac
aagctcttggatttcttcgggattgaccgcaataagattaaactgccgaagatcgtgccg
tcatcatcaccagacgctttcggaaggttgagatccgggatactggaaggtgttcgtatc
gcaggatgtttaggtgaccagtcttcagccttggtcggccaacaagggtttacacccggc
tctgcgaagaacacctacggtaccgggtgctttctgctttacaacgtgggcgaaaagcct
gttatctccacacatggattgctggccaccattgcgtatgactttggtgggaagcgaaaa
ccggtttatgcattggaaggcagtattgctgtcgcaggcagtggtgtcaagttcctaatg
aacaatatgggctttattacacattcgcacaagatcagcgacctggcagcctctgtcgaa
gacaacggtggatgtgtctttgtgacagccttcagtggtcttttcgcaccctactggatc
gatgatgccaagggcactatatttggtattacccagttcactgagcggggccatatcgct
cgcgcaactctggaagcgacttgcttccagaccagggcaatcttggatgccatggagctg
gacagtggccacaagttgaacatgcttgcagtcgacggtggcatgagtaactcaaacttg
tgcatgcagacacaagcaaatattattggcattcccgtggatcgacctgccatgcgcgag
actaccgcattgggggcagcgattgcagcaggattcgccgtcggtgtatggaaagaattt
gacgagctaaaggagatcaatcagaaagaccggatggtgttcaagccgaatattggcaaa
gaagagggggagaagatgttcaagaaatggggcagggcggtcgagatgtgccgtggttgg
ttagacgccggggaagccaacggagagttctcataa

DBGET integrated database retrieval system