KEGG   Pyrenophora teres: PTT_11744Help
Entry
PTT_11744         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pte  Pyrenophora teres
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pte00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 551 aa AA seqDB search
MATQDISARGSEPQPVPKEEIQDEPTGHLDEGKLRQFFIGSIDQGTTSTRFIIFDGLGEP
VAQHQIEFTQKYPQSGWHEHDPKEIITSVEQCIDRATNIFLDNGHDIEDIKAIGITNQRE
TTVLWDTNTGEPLCNAIAWPDTRTKGLVRELKGRPGADELLNICGLPLSTYPSSVKLRWM
LDHDENVRKAYDEGRLSFGTIDTWILYNLNGGKEAGIHVTDSTNASRTMFVNLHTVQYDD
KLLDFFGIDRNKIKLPKIVPSSSPDAFGRLRSGILEGVRIAGCLGDQSSALVGQQGFTPG
SAKNTYGTGCFLLYNVGEKPVISTHGLLATIAYDFGGKRKPVYALEGSIAVAGSGVKFLM
NNMGFITHSHKISDLAASVEDNGGCVFVTAFSGLFAPYWIDDAKGTIFGITQFTERGHIA
RATLEATCFQTRAILDAMELDSGHKLNMLAVDGGMSNSNLCMQTQANIIGIPVDRPAMRE
TTALGAAIAAGFAVGVWKEFDELKEINQKDRMVFKPNIGKEEGEKMFKKWGRAVEMCRGW
LDAGEANGEFS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctacacaagacatctctgcccgtggctcagaaccgcaaccagtacccaaggaagag
atccaggatgagcccacggggcacctagacgaagggaagctaagacagttcttcattgga
tctatagatcaaggaaccacaagtactcgcttcatcatctttgacggccttggtgagccc
gtggcccaacatcagattgagttcacccagaagtatccccagtctgggtggcacgaacac
gatcccaaagagattattacctcggtagagcaatgcatcgatagagcgacgaacatcttc
ctagacaatggccacgatatcgaagacatcaaggccattggtatcaccaaccagcgtgag
acgacagtcctctgggataccaacaccggagaacccctctgtaatgcaattgcttggcca
gataccaggaccaagggattggtccgtgagctgaaaggacggccaggcgccgatgagctg
ctaaacatatgtgggctgccgctgtcgacgtacccatcatcggtgaagcttcgatggatg
cttgaccatgatgaaaacgtcaggaaggcgtacgacgaaggtcgcctatcctttggcaca
atcgatacgtggatattatacaacctgaatggtggaaaggaagccgggattcatgtaacc
gactccactaacgcatcaagaaccatgtttgtgaatctgcacaccgttcagtacgatgac
aagctcttggatttcttcgggattgaccgcaataagattaaactgccgaagatcgtgccg
tcatcatcaccagacgctttcggaaggttgagatccgggatactggaaggtgttcgtatc
gcaggatgtttaggtgaccagtcttcagccttggtcggccaacaagggtttacacccggc
tctgcgaagaacacctacggtaccgggtgctttctgctttacaacgtgggcgaaaagcct
gttatctccacacatggattgctggccaccattgcgtatgactttggtgggaagcgaaaa
ccggtttatgcattggaaggcagtattgctgtcgcaggcagtggtgtcaagttcctaatg
aacaatatgggctttattacacattcgcacaagatcagcgacctggcagcctctgtcgaa
gacaacggtggatgtgtctttgtgacagccttcagtggtcttttcgcaccctactggatc
gatgatgccaagggcactatatttggtattacccagttcactgagcggggccatatcgct
cgcgcaactctggaagcgacttgcttccagaccagggcaatcttggatgccatggagctg
gacagtggccacaagttgaacatgcttgcagtcgacggtggcatgagtaactcaaacttg
tgcatgcagacacaagcaaatattattggcattcccgtggatcgacctgccatgcgcgag
actaccgcattgggggcagcgattgcagcaggattcgccgtcggtgtatggaaagaattt
gacgagctaaaggagatcaatcagaaagaccggatggtgttcaagccgaatattggcaaa
gaagagggggagaagatgttcaagaaatggggcagggcggtcgagatgtgccgtggttgg
ttagacgccggggaagccaacggagagttctcataa

DBGET integrated database retrieval system