KEGG   Pyrenophora teres: PTT_11769Help
Entry
PTT_11769         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pte  Pyrenophora teres
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:pte00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PTT_11769
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PTT_11769
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PTT_11769
Messenger RNA biogenesis [BR:pte03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PTT_11769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 405 aa AA seqDB search
MATTFKNMLHPVQHHRDKKDASSPSHAGPLHDRTDSAMDKPREEEKQHLAHWEAQKHTLS
PDQIDIDPEKKPVGHSSKVLRQEDFELIKTLGTGTFARVWLVRLKDAKAGDENKVFALKI
LRKVDVIRLKQVEHVRNERNVLAKVAGHPFITTMVASFQSLDSLYMVLDYCPGGEVFSYL
RRARRFNEPTSQFYAAEIVLILEFLHEREGVAYRDLKPENILIDAEGHLKLVDFGFAKKV
DNRETYTLCGTPEYLAPEVIRNTGHGTAVDWWAFGILVYEFLVGQPPFWDQNPMKIYEQI
VEGRVRFPSAMSPTARDLISGLCTVDTSKRLGNVAGGAQRVKQHEWFKNIDWEKLYNREV
QGPIVPHLRGPADTRNFDEYEPESDKRDPYTKELSDRWEDCFKDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgactaccttcaagaacatgctgcaccccgtccagcaccaccgcgacaagaaggac
gcctcttcgccctcgcatgccggcccgctccacgaccgcaccgattcggccatggacaag
ccgcgcgaggaagagaagcagcacttggcgcactgggaggcgcaaaagcataccctaagt
cccgaccaaatcgacatcgacccggagaagaagcccgtgggccattcatccaaggtgttg
cgacaggaagactttgagttgatcaaaacactgggcacgggtacttttgcgcgcgtgtgg
ctggtgcgattaaaggatgcaaaggccggcgacgagaacaaagttttcgccctaaagatc
ctgcgcaaggtagacgtcattcgtctcaagcaggtcgagcatgttcgcaacgagcgcaat
gtcctcgccaaagtcgcgggacaccccttcataaccaccatggtcgccagcttccagtcg
ctcgactcgctgtacatggtactcgactactgccccggtggtgaggtctttagctacctg
cgccgagcgcgacgcttcaacgaacccacttcccaattctatgccgccgaaatagtcctc
atactcgaattcctccacgaaagagaaggtgtcgcatacagagacctcaaacccgagaac
atcctcatagatgccgagggtcatcttaagctggtagattttgggtttgctaagaaagta
gataatagagaaacctacaccctctgcggcactcccgagtatctggctcccgaggtcatt
cgcaacacaggccacggtactgccgtcgattggtgggcttttggcattctagtatacgaa
ttccttgttggccaaccacccttctgggaccagaatcccatgaagatctacgaacaaatc
gtagaaggtcgtgttcgcttccctagtgccatgtctcccactgcccgcgacctcatttct
ggtctctgcacagtcgacacatcaaaacgtctcggcaatgtcgctggcggcgcccagcgc
gtcaagcaacatgaatggttcaagaacattgactgggaaaaactatataaccgcgaagta
caaggtcccatagtaccacacctaagaggtcccgccgatacacggaattttgacgagtat
gaacccgagtcggacaagagagacccctataccaaagaactgagcgatagatgggaggac
tgttttaaagacttttag

DBGET integrated database retrieval system