KEGG   Pyrenophora teres: PTT_11769Help
Entry
PTT_11769         CDS       T01613                                 

Definition
(RefSeq) hypothetical protein
Organism
pte  Pyrenophora teres
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 405 aa AA seqDB search
MATTFKNMLHPVQHHRDKKDASSPSHAGPLHDRTDSAMDKPREEEKQHLAHWEAQKHTLS
PDQIDIDPEKKPVGHSSKVLRQEDFELIKTLGTGTFARVWLVRLKDAKAGDENKVFALKI
LRKVDVIRLKQVEHVRNERNVLAKVAGHPFITTMVASFQSLDSLYMVLDYCPGGEVFSYL
RRARRFNEPTSQFYAAEIVLILEFLHEREGVAYRDLKPENILIDAEGHLKLVDFGFAKKV
DNRETYTLCGTPEYLAPEVIRNTGHGTAVDWWAFGILVYEFLVGQPPFWDQNPMKIYEQI
VEGRVRFPSAMSPTARDLISGLCTVDTSKRLGNVAGGAQRVKQHEWFKNIDWEKLYNREV
QGPIVPHLRGPADTRNFDEYEPESDKRDPYTKELSDRWEDCFKDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgactaccttcaagaacatgctgcaccccgtccagcaccaccgcgacaagaaggac
gcctcttcgccctcgcatgccggcccgctccacgaccgcaccgattcggccatggacaag
ccgcgcgaggaagagaagcagcacttggcgcactgggaggcgcaaaagcataccctaagt
cccgaccaaatcgacatcgacccggagaagaagcccgtgggccattcatccaaggtgttg
cgacaggaagactttgagttgatcaaaacactgggcacgggtacttttgcgcgcgtgtgg
ctggtgcgattaaaggatgcaaaggccggcgacgagaacaaagttttcgccctaaagatc
ctgcgcaaggtagacgtcattcgtctcaagcaggtcgagcatgttcgcaacgagcgcaat
gtcctcgccaaagtcgcgggacaccccttcataaccaccatggtcgccagcttccagtcg
ctcgactcgctgtacatggtactcgactactgccccggtggtgaggtctttagctacctg
cgccgagcgcgacgcttcaacgaacccacttcccaattctatgccgccgaaatagtcctc
atactcgaattcctccacgaaagagaaggtgtcgcatacagagacctcaaacccgagaac
atcctcatagatgccgagggtcatcttaagctggtagattttgggtttgctaagaaagta
gataatagagaaacctacaccctctgcggcactcccgagtatctggctcccgaggtcatt
cgcaacacaggccacggtactgccgtcgattggtgggcttttggcattctagtatacgaa
ttccttgttggccaaccacccttctgggaccagaatcccatgaagatctacgaacaaatc
gtagaaggtcgtgttcgcttccctagtgccatgtctcccactgcccgcgacctcatttct
ggtctctgcacagtcgacacatcaaaacgtctcggcaatgtcgctggcggcgcccagcgc
gtcaagcaacatgaatggttcaagaacattgactgggaaaaactatataaccgcgaagta
caaggtcccatagtaccacacctaagaggtcccgccgatacacggaattttgacgagtat
gaacccgagtcggacaagagagacccctataccaaagaactgagcgatagatgggaggac
tgttttaaagacttttag

DBGET integrated database retrieval system