KEGG   Pyrenophora teres: PTT_11976Help
Entry
PTT_11976         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PTT_11976
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PTT_11976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 585 aa AA seqDB search
MASIPVIVKHQGKKHEIEVDTTSTGETFKYQLFSITGVEPERQKVIVKGGQLKDDTDMSK
LGLKPNQTLMMMGTPSGSGKVIEKPKVPVKFLEDMDEAEAAQLEGATPAGLQNLGNTCYM
NSTLQTLRSIPELQEELLRYTASNDSGSSSSAHALSQLGLGGLGASTDLTGSLRDLFKQM
SETQQGFPPLMFLNALRTAFPQFAQKSKDGHGYAQQDAEEAWSQIVSQLRQKLKIKDNET
GSDANKKQELSWIDKYMAGKFESVMECDEPGAKEGGEEPVHSEDLFFKLNCHINVETNHL
RDGLAAGLKEQIEKRSEVLGRNALYTKTSKIARLPKHLPIHFVRFDWRRDTNKKAKIMRK
VTFPEELDALEFCTDELRKLLVPIRDKIRDVRKEEEDVERARKRQKRMKAGEENDTDPLA
NKEPLQKKKEAAQKKEDDGKPAEDTKMEEVEYKTDAQVEAERAASILAAKKELLALVDPK
MAADEGANQTGLYELRGVITHQGASADSGHYTSFVKKQGAKDPNTGKRKEEDGKWWWFND
EKVSEVDAERIQTLSGGGQSHSALILLYRAVPLPSIDEDVQMGEA
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctataccagtaattgtaaagcaccagggcaagaagcacgagatcgaagtcgat
accacgtccacgggcgagacgttcaagtatcagctcttctccatcaccggtgtcgagcct
gagcgtcaaaaggtcatcgtcaagggcggccagctcaaggatgacacggatatgagcaaa
ctgggcctcaagcccaatcagaccctcatgatgatgggcacgccctctggttcaggaaag
gtcatcgagaagcccaaggtccccgtaaagtttctggaggacatggacgaggccgaagcc
gcacagttggaaggcgccacaccggccggtctgcagaacttgggtaacacttgctacatg
aactcgacgctccagacgctgcgctctatcccagaactccaagaagagcttctgcggtac
actgccagcaacgactccggctcgtctagctccgctcacgcgctcagccagctcggtctc
ggtggccttggtgcctcgacagatctaactggctccctccgcgatctattcaagcaaatg
tccgagacccagcagggtttcccgccactgatgttcttgaacgccctccgaaccgcattc
ccccagttcgcccaaaaatcaaaagacggccacggctatgcacaacaggatgcggaggag
gcttggtcacagattgtctctcagttgcgccagaagttgaagattaaggataacgagaca
gggtcagacgcgaacaagaagcaagagctgtcctggatcgacaagtacatggccggcaag
ttcgagtcggtcatggagtgcgatgaaccaggtgccaaggagggtggcgaggaaccagta
cacagcgaggacctcttcttcaaactgaattgtcacattaatgttgagacaaatcatctt
agggacggtctggctgctggtctcaaggagcagattgagaagaggtctgaggttttgggc
aggaacgccctatacaccaagacgtcgaagatcgcacgcctgccaaagcacctgcccatt
cacttcgtgcgcttcgactggagacgcgataccaacaagaaggcaaagattatgcgcaag
gtcactttccccgaggagttggacgcgctggagttctgcacggatgaactaaggaagctc
ctggtccctatccgcgacaagatccgtgatgtccgcaaggaagaggaggacgtcgagcgt
gcccgtaagcgacagaagcgcatgaaggccggtgaggagaacgacactgatccgcttgcc
aacaaggagcctctgcagaagaagaaggaagccgcacaaaaaaaggaggatgacggcaag
ccagctgaggatacgaagatggaagaagtcgagtacaagaccgacgctcaagtagaggct
gaacgtgccgcatccatcttggctgccaagaaggagcttctcgctctcgtagatccaaag
atggccgccgacgagggagctaaccagacgggtctatacgagctcaggggtgttattacg
caccagggtgccagcgcggacagcggtcactacacatctttcgtcaagaagcagggtgcc
aaggatcccaacaccggcaagcggaaggaggaagacggcaagtggtggtggttcaatgat
gagaaggtctccgaggtcgatgctgagaggatacagactctctctggtggtggccaaagt
cactccgctcttattctcctataccgcgcggtccccctaccctctattgatgaggatgtg
cagatgggcgaggcatag

DBGET integrated database retrieval system