KEGG   Pyrenophora teres: PTT_12129Help
Entry
PTT_12129         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pte  Pyrenophora teres
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTT_12129
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PTT_12129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 615 aa AA seqDB search
MASASDVLTLVSSLALRLSIYIFLRWIPTTIVPSLATALTLVYIPSFFTSFQDTAQYKII
SDELDIIVKETVGGRSDDSGEEIKLIDGADDGPLEELDVQETVQYEEREPKVFRTLLTGL
PSPSSALLSWITFGINMALIAMTLDVVYRAPLLHQCHDASFARVGYVSENSAKILVREPY
AFDVKVLYRSIDDMERSWMEKTHRASQPDYWLTNETDFTMVMEIEHLRPDLSYEYIVETS
HGNTTGTFTTAPRPGHISQLKDNKYTFVHSSCIKPRVPYTPFQHPLEFPGMKHLARWLPE
LQPYFMLFLGDFIYVDVPHRQGNDAETYRREYRQVYSSPSWPAVSQNLPWIHVIDDHEIQ
NDWNSNMTGVAVPAYDAFTHYNAAPNPPPHREGVTYFSFTQGPAEFFLLDTRRYRSPVSK
DASGPAKTMLGTQQLSDLLDWIQRAPHQGVHWKFIVTGTPFTKNWQFGSEDTWGGHLHER
RRILEAAWDFSSTHDVGVVILSGDRHEFAATSFPPPKDGKWPVSATVHEFSTSPLSMFYL
PVRTYKEIDDEDVCLKYLPDGNSKFGAVEITTPVHGEQSFVNYRLFIDGEEAWTHVISTP
PGRGGSHRAKDAVWA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgcaagtgatgttcttacgcttgtcagctctctagccctacggctcagcata
tatatctttttgcgatggatacccactaccattgtcccatcacttgcgaccgcgcttacg
ctcgtatacattccgtccttcttcaccagcttccaggacacggcgcagtacaagatcata
tccgatgaactcgatataattgtaaaggagactgttggtggaaggagtgacgactcaggc
gaggaaataaagctcatcgacggcgcagatgacggcccattggaggagctcgatgtccaa
gagacggtgcaatacgaagaaagggagcccaaggtgttccggacactgctcaccgggctc
ccaagcccttcatcggcactattgagttggatcacctttggtatcaatatggccttgatt
gcaatgacgctggatgttgtctatcgtgccccattgctccatcaatgccacgacgccagc
tttgcgcgcgttgggtacgtgtcggagaacagtgcaaagatccttgtgcgagagccgtat
gcattcgatgtcaaagtactctaccgatctattgacgacatggagcgctcctggatggag
aagacgcatcgcgcaagccaacccgactactggctcacgaacgagaccgacttcacaatg
gtcatggaaatcgagcacttgcgacccgatttgtcttatgaatacattgtggaaacctcg
catgggaacaccactggtacttttaccaccgccccacgaccgggacacatatcacagctc
aaggacaacaaatacacgtttgtacattcgagctgcattaagcctcgcgtgccctacaca
ccgttccagcatcccctcgaattccctggtatgaaacatctggcgcgctggctaccagag
cttcagccgtactttatgctattcctcggcgacttcatttatgtcgatgtaccacaccgt
cagggcaatgacgctgagacatacagacgcgagtatcgacaggtctactcatcaccatca
tggccggcagttagccagaacttgccttggattcacgtcattgacgatcatgagatccag
aacgactggaatagcaacatgacgggtgtcgcagtccccgcctacgatgcctttacgcac
tacaacgccgcacccaacccaccaccccatcgcgaaggcgtaacatacttttccttcacc
cagggaccggctgagttcttcctcctcgatacgcgccgttaccgaagccctgttagcaaa
gacgcctccggccccgcgaagacaatgcttggaactcaacaattgtctgatctcctcgat
tggatccaaagggcaccacatcagggtgtccactggaagttcatcgtcaccggcacccca
ttcaccaaaaactggcaattcggctctgaagatacatggggcggacacctgcacgaacgt
cgtcgtattctagaagcggcctgggacttttcttcgacccacgacgtcggagtcgtcatc
ctaagcggcgaccgccacgaattcgcagccacatctttccctcctccaaaggacggaaag
tggcccgtcagcgccaccgtacacgagttcagcaccagcccactcagcatgttctacctt
cccgtccgcacatacaaggaaatcgatgacgaggacgtctgtctcaagtacctacctgac
ggcaatagcaagtttggtgccgtggagattacaacaccggtacatggagagcagagtttt
gttaattatagactttttattgatggggaggaggcttggacacatgttattagtacgccg
cctggcagaggggggagtcatagggcgaaggatgcggtttgggcgtga

DBGET integrated database retrieval system