KEGG   Pyrenophora teres: PTT_12281Help
Entry
PTT_12281         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PTT_12281
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PTT_12281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 616 aa AA seqDB search
MPEKPLTIATYAAGASLAAITLVYVFGPTYFLDDDANAASSKKKGVVGLSNAANDCFINS
VLQALAGLPDLRIYLIRETHRRLLDGPQVYDVDPESQDAAARPAKLEGLQRGILTHGLKD
VLDRLNERPLHKKTISPQPFIRTLERAFGTRISRQQQDAQEFLQIVTERLCDEYHAGGKA
RRQATRVGTGATNGDIGSRRREVEDQFGAVPAEGSGSDEVDDEADESATSAEEEGFPFEG
KIESQIECQTCHFKPKPTVSTFVTLTLNVPQASSTSLNACLDGMLKVEYIEDFKCERCRL
EHALRSKDHELSRATNLNLQQRLRSDISKIRQALEEDPETPPEGVELPDSSQAPKRRIAR
HMYISQFPKVLAIHLSRSTFAFGSTSTKNMAKVAFPEALPLGGILHRKNYRLLCMVTHKG
SHNSGHYESFRRQVQRLPFSTPASFGTEGAYSRQASPHPSAAPSVAPSAMQSPRISALNL
ANSIDRGSPTPSTPTLDSPSTRSLSSQDNIPSSSRGPAPTSAPRISESDPVLRTASTDTG
NRSESLSRTRSIRSIKERASEKASSMAEANPLRRKSKKAHNRWWRISDDKIKESKTSEVL
NMQKDVYLLFYELDKR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagaagccccttaccattgcaacctacgctgcaggcgcctcactcgccgccatt
acactggtctacgtctttggcccgacctacttcttggacgacgatgcaaatgcagctagt
agcaagaagaaaggcgtagtgggcctcagcaacgcggcgaatgactgcttcatcaattcc
gtgctacaagccctcgccggtttgccagatttgcgcatatatctcataagagaaacgcat
aggcggctactcgacggtccccaagtatacgatgtggaccctgaaagccaggatgctgcc
gcgaggccggccaagctcgagggactgcagaggggcatcctcacccacggcctgaaggat
gttctcgacaggctgaacgaacggccgttacataagaaaacaatatctccccaacctttc
atccgtacactcgagcgcgcatttggcacccgcatcagccggcagcaacaggatgcgcaa
gagtttctgcagatagtcacagagcgcctatgcgacgaatatcacgctggtggaaaggct
cgacggcaggctacacgcgttggaactggtgcaaccaacggagacattgggtcgcggaga
agagaagttgaggaccagttcggcgcggtgcctgccgagggctcaggcagcgatgaagtc
gatgatgaggctgacgagagcgcaacatctgcagaagaagagggatttccctttgagggc
aagatcgagtcgcagatcgagtgccaaacctgtcactttaagccgaagcccacagtatca
acatttgtcaccctgaccttgaacgtaccgcaggcgtcctccacttcgctcaacgcctgt
cttgatggcatgctcaaggttgagtacatagaagacttcaagtgtgagcggtgtcggctc
gagcatgcactcaggagtaaagaccatgagctttcaagagccactaatctgaaccttcag
caacggttaagatcagacatctcaaagattcgacaagcattggaggaagaccctgaaacc
ccgcctgaaggtgtggagctccctgattcgagccaggcacccaagcggcgtatagcgcgc
catatgtacatatcacagtttccaaaggttcttgcgatacacctgtcgcgttccacattt
gcgtttggttctacctctacgaagaacatggccaaggtcgccttccctgaagctctacca
ttaggtgggatcctccaccgcaagaactatcgcttgctctgcatggtcacccacaaaggt
agccataacagcggccattacgagtcttttcgccgccaagtacagcgactgcctttctcg
acgcccgcttcctttggtacagaaggtgcatacagtcgccaagccagtccgcacccgtcc
gcagcaccgtcagtagcaccgtccgcaatgcaaagtccacgcatctctgcccttaacctt
gccaacagtattgaccgcggctcaccgaccccttctacaccaactctcgactctccatcg
acacgctcgctatcctcccaagataacataccttcctcatcacgaggtcctgccccaaca
tcagcacctcgaatctccgagtcggatcctgtactaagaacggcatccactgacactgga
aacagaagcgagtcgttatcccgcacgagaagcatacgctcaattaaggagcgagcatca
gaaaaggcatcatccatggcggaggctaatcctctgcggagaaagtcgaaaaaggcgcat
aatagatggtggcgcataagtgatgacaaaatcaaagagagtaagacgtcggaggttttg
aacatgcagaaagatgtttatctgctattctatgagttggacaagagatag

DBGET integrated database retrieval system