KEGG   Pyrenophora teres: PTT_12595Help
Entry
PTT_12595         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pte  Pyrenophora teres
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PTT_12595
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    PTT_12595
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     PTT_12595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 300 aa AA seqDB search
MSQLSHARYGKDNVRLYKVDKDPKTGIHKVIEQTVCVLLEGDIDVSYTKADNSVIVATDT
QKQTTYILAKQHPIDPPEQFAAIIGDHFVKTYPHIHAAHVKIIQHRWTRMTIDGKAHPHS
FYRDGEEIRVVESVTREGQGVSIRSKIEKLLVLKSTGSAFHGFHRDEYTRLPETWDRILS
TEIEAGWQWKLFKTVEEAKAVDFNAAWTAARDITMKVFAEDDSASVQATMYKMCDLILAA
LPQVEAVDYALPNKHYFEIDMSWHKGIKNTGKDATVFAPQSDPNGLIHCTVTRKGAKAKL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaactcagccacgcccgctatggcaaggacaatgtccgcctgtacaaggtcgac
aaggaccccaagaccggcattcacaaagtcatcgaacagacagtttgcgtcctacttgag
ggagacattgacgtctcctacactaaagcagataactctgtgatagttgcaaccgatacg
caaaagcaaacaacctatatcctcgccaagcagcaccccatcgacccccccgagcagttt
gccgctattatcggcgatcactttgtcaaaacgtacccgcatattcacgcggcacatgtc
aagattatccagcaccgatggacgcgcatgaccatcgatggcaaagcccacccgcactcc
ttctaccgcgacggtgaggagatccgcgtagtcgagtctgtaacgcgagagggccagggc
gtgtccatccgctccaagattgagaagctgctcgtgctgaagagtacgggttcagcattc
catggcttccatcgcgatgaatacactaggttgcctgagacatgggaccgcattcttagc
acggagatcgaagcagggtggcaatggaagttgttcaagaccgtggaagaagccaaggct
gttgacttcaatgctgcatggacggcagctagggatattaccatgaaggtctttgccgag
gacgacagcgcgagtgtacaggcaaccatgtacaaaatgtgcgatctgatcctggctgct
cttccccaagtcgaggctgttgactatgcgctacccaacaagcactacttcgaaattgat
atgtcatggcacaagggcatcaagaacacgggcaaagacgccacggtatttgcacctcaa
tccgaccctaacggtctcatccattgcactgttacccgcaagggtgcaaaggccaagcta
tag

DBGET integrated database retrieval system