KEGG   Pyrenophora teres: PTT_12595Help
Entry
PTT_12595         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pte  Pyrenophora teres
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pte00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:pte00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 300 aa AA seqDB search
MSQLSHARYGKDNVRLYKVDKDPKTGIHKVIEQTVCVLLEGDIDVSYTKADNSVIVATDT
QKQTTYILAKQHPIDPPEQFAAIIGDHFVKTYPHIHAAHVKIIQHRWTRMTIDGKAHPHS
FYRDGEEIRVVESVTREGQGVSIRSKIEKLLVLKSTGSAFHGFHRDEYTRLPETWDRILS
TEIEAGWQWKLFKTVEEAKAVDFNAAWTAARDITMKVFAEDDSASVQATMYKMCDLILAA
LPQVEAVDYALPNKHYFEIDMSWHKGIKNTGKDATVFAPQSDPNGLIHCTVTRKGAKAKL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaactcagccacgcccgctatggcaaggacaatgtccgcctgtacaaggtcgac
aaggaccccaagaccggcattcacaaagtcatcgaacagacagtttgcgtcctacttgag
ggagacattgacgtctcctacactaaagcagataactctgtgatagttgcaaccgatacg
caaaagcaaacaacctatatcctcgccaagcagcaccccatcgacccccccgagcagttt
gccgctattatcggcgatcactttgtcaaaacgtacccgcatattcacgcggcacatgtc
aagattatccagcaccgatggacgcgcatgaccatcgatggcaaagcccacccgcactcc
ttctaccgcgacggtgaggagatccgcgtagtcgagtctgtaacgcgagagggccagggc
gtgtccatccgctccaagattgagaagctgctcgtgctgaagagtacgggttcagcattc
catggcttccatcgcgatgaatacactaggttgcctgagacatgggaccgcattcttagc
acggagatcgaagcagggtggcaatggaagttgttcaagaccgtggaagaagccaaggct
gttgacttcaatgctgcatggacggcagctagggatattaccatgaaggtctttgccgag
gacgacagcgcgagtgtacaggcaaccatgtacaaaatgtgcgatctgatcctggctgct
cttccccaagtcgaggctgttgactatgcgctacccaacaagcactacttcgaaattgat
atgtcatggcacaagggcatcaagaacacgggcaaagacgccacggtatttgcacctcaa
tccgaccctaacggtctcatccattgcactgttacccgcaagggtgcaaaggccaagcta
tag

DBGET integrated database retrieval system