KEGG   Pyrenophora teres: PTT_12613Help
Entry
PTT_12613         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pte  Pyrenophora teres
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTT_12613
Enzymes [BR:pte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PTT_12613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 329 aa AA seqDB search
MEADAPKPSPSALPMHMTNGSPLRLTTEARHKKERENLFNAIETSNRGRQVVNFDGPTSY
FPAKASAPKTGVSGVHDRNTMTTNGVHGLGDEAEDAVAQTPLATSRAHSPYTQHPTIDFD
GLSWPSKGTRERKEATEEEKAANLAKLSGAVRTMLECLGEDPDREGLLDTPERYAKALLF
FTKGYEENLRDIVNGAVFHEDHDELVIVRDIEIFSLCEHHLVPFTGKMHIGYIPNRRVIG
LSKLARIAEMFARRLQVQERLTKQVALALSEMLQPQGVAVVVESSHLCMVMRGVQKTGTT
TTTSCMLGCMRSRDKTRQEFLNLINRNKQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgacgcgcccaaaccttcgccatcagcccttccaatgcatatgacaaacggc
tctcccctgcggctcaccaccgaagcgcgacataagaaggagagggaaaatctcttcaat
gccatagaaacttccaaccgaggccgccaggtagtaaacttcgacggcccgactagctat
ttccccgccaaagcgtctgcgccaaagactggcgtcagcggcgtgcacgacaggaataca
atgacgacaaacggtgtacacggccttggggacgaggctgaggatgcggttgcacaaaca
ccgcttgcgaccagtcgcgcccatagtccatacacgcaacaccccaccattgactttgac
ggcctcagctggcccagcaagggcacgcgtgagcggaaagaggcgaccgaggaagaaaag
gctgcaaaccttgccaagctgtcgggcgcggtgcgcactatgctcgagtgcctaggcgaa
gaccccgaccgcgagggactgttggatacaccggagagatatgcaaaggccctgctcttc
ttcacaaagggctacgaggagaatctgcgcgacattgtcaacggcgccgtcttccacgag
gaccacgacgagttggtcattgtgagggatattgagatcttctccttgtgcgagcaccat
ctggtgccattcactggcaagatgcacattggctacatccccaaccgtcgcgtcataggt
ctctccaaactcgcccgcattgccgaaatgttcgctcgtcgtcttcaggttcaagagcgc
ctcactaagcaggtcgcgctcgccctatcagagatgctccagccacaaggcgtcgccgtc
gttgtcgaatcgagccatctttgcatggtcatgcgcggcgttcaaaagacgggtactacc
accactacaagctgtatgctcggatgcatgcgatcgagggacaagacgcgccaggagttc
ttgaacctcatcaacagaaacaagcaatag

DBGET integrated database retrieval system