KEGG   Pyrenophora teres: PTT_12765Help
Entry
PTT_12765         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pte  Pyrenophora teres
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:pte00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PTT_12765
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PTT_12765
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: Other group
  TTK family
   PTT_12765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 581 aa AA seqDB search
MSTASPTPLGGSSSYGRMRAQSSIRPRRDSPLSVLGQSQGFSADAPMLQNIEIDSSDDEI
PQPMKLSALTTALLAQGNDVDSPEKRKPKLKISRNASPGSNTPVQDSVTPAPSLRIKRVP
LRGAPMRRLRRTPQSEEENAPSQDQENQPISVKVQPENVPDSVLKATGSVMKVAEDRKHP
PQEHQSPIQRSSQQHEKHMPLQALSANTPRRPAPPPPPKMSVLETATAAAGAATTKTRER
KKRSTLSVNGKHYSQMDRIGRGGSSAVYRVMAENFKLLALKRVKLEDADEAAVRGFKGEI
DLLQKLKNVDRVVRLYDWEVDEQRQVLSVLMELGESDLARIIRMKLDAADGDGKLDLSFT
RYYWKEMLECVGAVHDHDIVHSDLKPANFLLTSGRLKLIDFGIANAIEVDHTVNVHRDSH
IGTPNYMSPESLEDSAGGARGLLSNGNGSKDMALGKPSDVWSLGCILYQMVYGRPPFAHI
TNPMARVLAIVNRDYEIAFPDLGVGEVRVPPGLKATLRRCLQRDPARRPNITQLLDQRDP
FLYPDGGDDLRIPQDLLGQIIQRVADRFRDPNKAAPTDDEI
NT seq 1744 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgcgtcgcccacgccgctaggcgggtcctcctcatatgggcgcatgcgcgcg
caatcttcgataagaccccggagagactctccactatcagtattgggtcagtcgcagggc
ttctctgcggacgcgcccatgttgcaaaacatcgaaatcgacagctccgacgacgaaatt
ccgcagcccatgaagctcagcgctttgacaactgcgctgctggcacaaggcaacgacgtg
gactcgcccgagaagcggaaaccaaaactcaagatatcgcgcaatgcctccccaggttca
aatacaccagtgcaggattctgtgacgcctgcgccaagtctgcgaatcaaacgggtaccg
cttcgtggcgcacccatgaggaggttacggaggactccccagagcgaagaagagaatgct
ccctcacaggaccaggaaaaccagcccatctccgtcaaggtgcaaccggaaaacgtaccg
gattccgtgttgaaagccactggttcagtcatgaaggtcgcagaggatcgcaagcaccca
ccacaagagcatcaatcacccatacaacgatcgtcgcagcaacatgagaagcacatgcca
ctacaggcgctgagtgcgaacacccctcgcagaccagctcccccgccgccaccgaagatg
tccgtgcttgagacggcgaccgctgctgcaggagctgccaccaccaagacaagggaaaga
aagaaaagaagcacgctatcagtcaatggaaagcactattcgcaaatggacagaatagga
agaggtgggagttcagcagtctaccgcgtcatggccgagaatttcaagctcctagcactg
aaaagagtcaagctcgaggatgccgacgaggcggctgtacgcggcttcaagggcgagatt
gatctcctccaaaagcttaagaatgtggatcgggttgtacgattgtacgactgggaggta
gacgagcaacggcaggtccttagtgtgctcatggaacttggcgaatccgacttggcccgt
ataatacgaatgaagctcgacgctgccgatggcgacggcaagctagacctcagcttcaca
cgctactactggaaagaaatgctcgagtgcgtaggcgcagtacacgaccacgacattgtg
cactctgatctcaaacccgcaaactttctcctcacctccggccgcctcaagctcatcgac
tttggcatcgcaaacgccatcgaagtcgaccatacagtaaatgtgcaccgcgactcccac
atcggcacccccaattatatgtcaccagaatccctcgaagactccgccggtggtgctcgc
ggcctcctcagcaatggcaacggctccaaggacatggctctcggcaaaccctccgatgtc
tggagtctcggctgcatcctctaccaaatggtctatggccgacccccctttgcccacatc
acaaacccaatggcccgcgtcctcgcaatcgtaaaccgcgactacgaaatcgcttttccc
gacctcggcgtcggtgaagtccgcgtcccgcccggcctcaaagcaacgctccgccgctgt
ctccagcgtgaccccgctcgcagacccaatatcacacagctcctcgatcaaagagatccc
ttcctctacccagatggcggcgatgatttgcgcatcccgcaggatttgctcggccagatt
atccaaagggttgcggatcgctttcgggatcctaataaggctgcgcctactgatgatgaa
attc

DBGET integrated database retrieval system