KEGG   Pyrenophora teres: PTT_12782Help
Entry
PTT_12782         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 2100 aa AA seqDB search
MDPQSVAFQPRDDFWRIQSEMLRVQESQADLADRVARLERKQEDDSRLKNVWGASSPFPS
VLGGTPQQGMMPLQQPTAEHFSNFDDQSSNLIGNLQLDADEEPRRIGATSRANSVRFDET
ANHGHWAHASRSSLDLIPRTGSGMGGHVMSERSYSHKSDGRQSSAGHSVHSMASGRANSL
TSCGPTPPQDAPGLAPGLFILGSVPAIIRCWLNTNFKHDTLLYAAVCSGSYTSYLDLHLV
EHLGFQDQVILSDDGLRKIKLSVYLPEAVPVSASSRSNSPAPQLPSVAVDFTIIEEHNAA
TNPKAIQILLGSDMLRAHNADLLFSCSQLTLYDDDHSKLQIPLVRPEDDRAFKSLHVSSL
SRASTMERGSVPASTRVDSMSENPSKSVAHEQFPSADKSNGMETAPSSDDGGSSGRTSLE
QRPHLALSASSRSDTRETQDPASASGAPRSGASPAIWSSWRRDQGEKTSTGSGSLDWASV
GKTASSNPSYQRRDTGIKVLKPSKAVRTMSTSNPSPVTGQSRFFDDGKRRGETEAWSNPA
PPPAKRSVSSEKGKENVPALSKPRSANPRKIVAPAKESPDARDGTHSPNVCSAGVGSPRS
SPQPSASPPRYLPPHLHDEVLVDASTSDSASHVSRDCYTGASSPSEAYANLTLDTHDAYI
TDLDRTRTAEQVAQRPPPRASSPAKRLHSDMDDKADVGSGTSSNPRTGKPLPAGASQRSA
RAPSVDMADAPGSASPEGNHGDAASAVLSTDMDDAQPSNLPSIDEQVTRVMGMMSSEPLV
DGQEGYIISERWLERVWARTSENVTRPQDFSKEATQGPVGPVDNSHLVDTQLLQEELLDQ
HGDNFIPLSKAATLGQDFEILPRKAWDLVLSWYGHKAASPVIRRHAHNTVPGQYSMDISY
ELHPPIITIRKVRKTPNATENTKPAERIVASRYESFVAFIDAAKKAVGIETANKVRMWRI
LTSAPTDQPQPSQTAGILTPDASPRNGSPVAPAPGARPSLVMDIADFNSLAYGSERELVT
GKDEKANEEDNESLTLADAGLTQDQTIVLEEHDEQGEYISDATKVVSKNKAGSVASKGLQ
SNPTSGRNTPSGGPMTRSRKQNGKVRGHVGLTNLGNTCYMNSALQCLRSVEELSMYFLNN
KWKEEINVDNPIGHKGVIAKSYAGLLSAIFSLDNNSAVSPKDFKQKLGKANTLFSGYGQQ
DSQEFVSWLVDALHEDLNRIHKKPYCENPDSTDDTFRDPEAIRKLGEVYRNNHRARNDSV
AMDLFSGFYKNTMVCPDCEKVSITFDPYSQLTLQLPIEQTWSHTITYVPLYGKPYQLEVD
IDKNATIKALKDHKFYRHLDDSATVSESNIGARDEIYFYELDMAPSNWPAPKKKGSKYKT
ILSQSSDEDIPETVSPLHDRILVPLFHRGNSTSAHRSSGHAMALWPSFIVLTRDEAKDYD
AILRKVLVKVSQMTTRKILSELSSLDQSRPGSDVVLTTEEDASPNDPQVKDGSVEGEKDM
VEVTMTDTNETTPPQTDESNQMPEILRPGSYIHPEFRHLFEMKHTRRGTEIVTTGWSTID
AARALEPIHKRVRIPPSREESVQSSTNGSSTTSSDEDEDTSQSTVVDANAAIDAANVSSD
EEMQSIEPNAPEFARSGRQNKKKSKKARKHERKMERKHKNNKNFKHRKGGKVVDEPNYPE
EPENDSDESLIRMGEALVLDWNAESMDALFGASSDDDARGMNIMKLTEVLDDPEIQEKKA
NRAARRKNGINLDACFVESSKSEVLSEDNAWYCSRCKELRRATKTLEIWTVPDILIIHLK
RFSGHRTFRDKIEELVDFPVEGLDLSGKVGFPEGKDLTYDLFAVDNHYGGLGGGHYTAYA
QNFFDKQWYEYNDSIVSRCDSRKPVSRAAYLLFYRRRSPVPLGPPSLQQIVTTDMSNPGS
DDDNTDADDQQPRSRSPAGNGSRLDGSSRNGSSSAGAIGAGVGALRGGGYQRSAAENLPK
NGAGAASLSDDELPPYEDVDEGFAEESYGTTPWESGDQPLWSFNSLNDSNARNTADSDDD
GIASDTGAQGSVGDSMELRDRLMEDFGDDEGPGKGPWSGGMGTPVTQQEDDVAEIRLVED
NT seq 6303 nt NT seq  +upstreamnt  +downstreamnt
atggatccccagagcgtagcgttccagccgcgcgacgatttctggcgcatccaaagcgag
atgctccgtgtgcaggagagccaagctgacctcgctgaccgcgttgctcgtctggaacgc
aagcaagaggacgactcgcgcctgaagaacgtctggggggcctcttcgccctttccctct
gttctgggaggcacaccgcagcaaggcatgatgcccctgcaacagcccacggccgagcac
ttctccaactttgacgaccagtcgagcaatctcatcggcaacctccagctcgatgccgat
gaggagcctcgccggataggcgccacttcgcgtgcaaatagcgttcgttttgacgagacg
gccaaccatggtcattgggcacacgcatcgcgttcgtcactggatctcataccccgcact
ggcagcggcatgggcgggcacgtcatgagcgagcgcagctattcgcacaagtcggacggc
agacagagctccgctggacactctgtgcattccatggcatctggtcgcgcaaacagcctt
acaagttgtgggccgacgccgccgcaagacgccccaggactggctcctggcctgtttata
ctcggctctgtgccggccataatacgttgctggctcaacactaatttcaagcacgacacg
ttgttatatgcagccgtgtgctccggctcctacacttcgtacctagatctccacttagtc
gagcatcttggcttccaggaccaggtcatcttgtccgatgacgggctccgcaagatcaag
ctctctgtctatctcccagaagccgtgccggtttcagcctcatcacgctcaaacagcccg
gcgccgcagctaccatctgtcgccgtggatttcaccatcatcgaggagcataatgcggcg
accaatccaaaggctatccagatcctacttggcagcgacatgctccgcgcacacaacgcc
gacttactgttctcttgtagtcagctaacgctctatgatgatgatcacagcaaactgcag
atacccctggtgcgcccggaagacgatcgcgcgttcaagtccctgcatgtctctagtcta
tctcgtgcttcgaccatggagcgaggctctgtgcccgcctcaacacgcgtcgacagcatg
agcgagaatccttccaaatcagtagcacatgagcagtttccgtcggctgacaagtccaat
ggcatggaaactgcacccagctctgatgatgggggatcgagtggacggacgagtcttgag
cagcgtccacacctcgctctttcagcatcgagtcgctctgatactagggagacacaggat
ccagcttctgccagtggggcgccaagatcaggtgcatccccagctatctggagcagttgg
cgccgggatcaaggcgaaaagacaagcacaggttctggttcattggattgggctagcgtg
ggtaaaaccgccagctcgaatcctagctaccaacgccgtgatacgggtataaaagtgcta
aagccgtcgaaagcggtgcgcaccatgtccacgtccaacccatcgccagtgacaggacag
tcacgcttcttcgatgacggaaagcgaagaggcgaaacggaggcgtggagtaatccggca
cctcctccggcaaagagaagcgtgtctagcgaaaagggaaaggaaaacgtacccgcactt
tcgaagccgcggtctgcgaatccacggaagatcgtggcccccgcaaaagaatcgccagac
gctagggacggcacccattcaccgaatgtgtgcagcgctggtgtagggtcccctcgctcc
tccccgcagccctcagcatctccaccacgctatctgccaccgcacctgcacgacgaggtc
ctcgttgacgcttccacgtccgactcagccagccacgtgtcaagagactgctacacgggc
gcaagctcgcccagcgaagcctacgccaacctgaccctcgacacccacgacgcctacatt
actgacctcgaccgcacacgcaccgccgaacaagtcgcccaacggccgcctccacgagct
tcttcgcccgccaagcgccttcactcagacatggacgacaaagcagacgtgggcagcggc
acgtcgtccaaccctcgcacgggcaagccactgccagccggcgcatcacagcgcagtgca
cgcgcgccatcggtggacatggcagacgcgcccggcagtgccagccccgagggcaatcat
ggcgatgctgcctctgccgtgctgtccacagacatggacgatgcacagccgtccaatctc
cccagcatcgatgagcaggtcacgcgcgtcatgggcatgatgtccagtgagcctctggtc
gacgggcaggaaggctacatcatctcggagcgctggctggagcgggtatgggcgaggaca
tcggagaacgtcacaaggccccaggatttcagcaaggaagccacacagggtccagttggt
cccgtcgacaactcacacctcgtggacacgcaactgctgcaagaagaactgcttgaccag
cacggcgataacttcatcccgctgagcaaggcagctacgcttggtcaagactttgagatc
ttgcctcgcaaggcctgggacttggtattgagctggtacggccacaaggcggcgtcaccc
gtgatacggcggcacgcccataatacggtaccgggccagtattccatggacatttcatac
gagctacatccacccattattactatacgaaaagtgcggaaaacgccaaatgcgacagaa
aataccaaacctgcagagagaattgtcgcgagccgatacgagagctttgtcgccttcatc
gacgctgcaaagaaggctgtaggtatcgaaactgccaacaaggttcgcatgtggagaatc
ctaacatcggcgccaaccgaccaacctcagccgtctcaaactgccgggatactcactcca
gacgcatcgccacgcaacggctcgcccgttgcgccagcacctggtgcccggccgtctcta
gtcatggatatcgcggatttcaacagccttgcctatggatcagaacgtgagctcgtcaca
ggcaaggacgagaaggcgaatgaggaggataatgaatctttgaccctggccgatgccggt
cttacacaggaccaaaccattgtgctcgaggaacatgacgaacagggcgagtacatctca
gatgcgaccaaggtggtgtccaagaacaaggccggctctgtggctagcaaaggcctacag
agcaacccgaccagcggtaggaataccccaagcggagggcccatgactcgctcaaggaaa
cagaacggcaaggtcagaggtcatgttgggctcaccaacctcggcaatacctgctacatg
aactcagccctgcagtgtctccgaagtgttgaagagctgagcatgtactttttgaacaac
aaatggaaagaagagatcaacgtcgataaccccataggtcacaagggtgtaattgcaaag
tcgtatgctgggctgctaagcgccatcttcagcctcgataacaactctgccgtctccccc
aaggacttcaagcagaagcttggcaaagcgaacactttgttctcaggatatgggcaacag
gactctcaggagtttgtcagctggctagtcgatgcgttacacgaagacctcaacaggata
cacaagaagccctactgtgaaaaccctgattctaccgacgacactttccgcgacccagag
gccataaggaagctcggcgaggtctatcgcaacaaccaccgtgctcggaatgactcggtg
gccatggatttgttcagtggcttctacaagaacaccatggtctgcccagattgcgagaaa
gtcagcatcacgttcgacccatacagccagctcaccctccagttgcctatagaacaaacc
tggtcgcataccattacatacgtgccgctttacggcaaaccttatcagctcgaggttgac
atcgacaagaatgccacaatcaaggccctgaaagaccataagttctaccgccacctcgac
gactcagccactgtttcagaatctaacataggcgcgagagatgaaatatatttctacgaa
cttgatatggctcctagcaactggcccgctccgaagaagaagggttcgaaatataagacc
attctctctcagtcttctgacgaggatattccagaaacggtttctccgctccacgaccgc
atcttggtcccgcttttccaccgtggcaatagcacctctgcacatagatcatctggtcat
gctatggcactatggcccagtttcattgttcttacgcgggacgaagcaaaggattacgat
gcaatcctaagaaaggtcttagtcaaggtttctcaaatgactactcgaaagattcttagt
gaactcagcagtctcgatcaatcacggcctggctctgatgttgtgctgacaacagaggaa
gatgcgtcgccaaatgacccacaggtcaaagatgggtccgtcgaaggtgaaaaagatatg
gtcgaagtcacaatgacggatacaaacgagacaaccccgccgcaaactgacgagtctaat
caaatgcctgaaattctccggccgggtagctatattcaccccgagtttaggcacttgttc
gaaatgaaacatacacgaaggggcaccgagattgtcactacaggctggagcactatcgac
gccgcacgcgcactggagcctatccacaagcgcgtacggataccaccctcaagagaagag
tctgtgcagtcatccacaaatggaagttcgaccacgtccagtgacgaggatgaggacaca
tctcaatcgactgttgttgacgccaatgctgcaattgatgcagcaaatgtcagcagcgac
gaggagatgcaatcaatcgagccgaacgcgccggaatttgctcgatctggacgccagaac
aagaagaagagtaaaaaggcgcggaaacacgaacgtaaaatggaacgtaagcacaaaaac
aacaagaacttcaagcaccgaaaggggggtaaggtagttgatgagccgaattacccagag
gaaccagaaaacgacagtgacgagagcttgatccgtatgggtgaggcactcgttctcgac
tggaacgcggaatccatggatgctttgtttggagctagttcagatgacgatgctaggggc
atgaacatcatgaagctcacggaagtgcttgatgacccagaaatccaggagaagaaggcg
aatcgtgctgctcgtaggaagaacggcattaacctcgatgcgtgtttcgtcgaatcttca
aagagcgaagtgctttccgaggacaacgcatggtattgcagtcgctgcaaggaactgcga
agggcaacaaagacactagaaatttggacagtcccggacatattgatcatacacctcaag
cgcttcagtgggcaccgaacgttccgagacaaaatagaagaattggtagacttcccagtc
gagggactagacctgtcaggtaaagtcggatttcccgaaggtaaagaccttacctacgat
ctgttcgctgtcgacaatcactatggcggactgggtggtggacactacacggcttacgct
caaaatttcttcgacaagcagtggtacgaatacaacgattctatcgtctctcgatgtgac
agtcgcaagcccgtttctagagctgcctatctactcttttaccgacgacgctcgcctgtc
cctttaggcccaccatcgcttcaacagatcgtcacaaccgacatgagcaatccaggctct
gatgacgataacacggacgcagacgaccaacaaccgcgctctcgctcgccggcgggaaac
ggctcgcgcctcgacggttcgtcccgcaatgggtcgtcgagcgctggcgcgataggagcg
ggagtcggagccctgcgcgggggtggctatcagcgctcagcagccgagaaccttccaaag
aacggagccggagccgcgagcctgagtgatgatgaactaccgccgtatgaggatgtcgac
gagggctttgccgaagagtcgtacggcacgactccgtgggagagcggcgaccagcccctc
tggagtttcaactctctaaacgatagcaatgcgaggaatactgcagactcggacgatgat
ggcatcgcatcagacacgggtgctcaaggatctgtcggcgatagcatggaactccgtgac
aggttgatggaggactttggcgatgacgagggtcctggaaagggaccgtggagcggtggt
atgggcactcccgttacacaacaagaagatgacgttgcagaaatcaggctcgtggaggat
tga

DBGET integrated database retrieval system