KEGG   Pyrenophora teres: PTT_12790Help
Entry
PTT_12790         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pte  Pyrenophora teres
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pte04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 473 aa AA seqDB search
MPTLGFLKKKRTKDSNGSRDLDSPTSPIKDTATPITPTTSRKSGSFHLHKTKTNESLTNT
TTNTTAPAAPAAQTKPADSMNPAYAQQQQQQQQSQQQQQQQHGASPQSNPQSSHNTPSIQ
NLIHPNNATSPQSPAKNGAVQFQTQPLNQARVTKGKYSLTDFTIQRTLGTGSFGRVHLVQ
SKHNQRFYAVKVLKKAQVVKMKQVEHTNDERRMLQQVKHPFLITLWGTFQDSKNLYMVMD
FVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALDYLHSHNIIYRDLKPENLLLDRHGHLK
ITDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIFEMLCGFTPFWDG
GSPMKIYENILKSRVKYPPYIHPDAHDLLQKLITPDLTKRLGNLHGGSKDVMNHPWFAEV
TWDRLQKKDIDAPYVPPVRAGVGDASQFDKYPEETEAYGQAGDDPHGHLFPDF
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccctgggcttcctcaagaagaagcggacgaaggactcgaacggctccagagac
ctggattcgccgacttcgcccatcaaagacacagccacgcccatcacgcccacaacgtcg
cgcaagtcgggctcgttccatcttcacaagacaaagaccaacgagtcgctcaccaacacg
accaccaacaccacggccccggctgcgcctgccgcccaaaccaagccggccgactcaatg
aaccccgcctatgcgcaacagcagcagcagcagcagcaatcgcagcagcaacagcaacag
caacatggcgcgagcccgcagtccaacccgcagtcttcgcacaacacacccagcatacag
aatctaatacaccccaacaatgccacctcgccccagtcacctgctaagaatggcgccgtg
cagttccagacgcagccgctcaaccaggcgcgcgtcacaaagggaaagtactcgctgacc
gactttaccatccagcgcaccctcggcaccggcagctttggccgagttcatctggtccag
tccaagcacaatcagcgcttctacgccgtcaaggtgctgaagaaggcccaggtggtcaag
atgaagcaggtcgagcacacgaatgatgaacggcgcatgctccaacaggtcaagcatccg
ttcctcatcaccctgtggggaacttttcaagattccaagaatctctacatggtcatggac
tttgtagaaggaggcgagctgttcagtctgctgcgaaagtcccagcgctttcccaaccct
gtcgcaaagttctacgccgccgaggtcacactggcgctcgactacctgcactcgcacaat
atcatctatcgcgacttgaagcctgaaaacttgcttctagaccgccatggccatctcaaa
atcaccgactttggattcgccaaagaagtcccagacattacatggaccctgtgtggtacc
ccggactacttggcgcccgaggtcgttgcctcaaagggctacaacaaatctgtagattgg
tggtcgcttggtatcctcatcttcgaaatgctgtgcggctttacgcctttctgggacggc
ggctcgcccatgaagatctacgaaaacatcctaaagtcgagagtcaagtacccgccatac
atccaccccgacgcgcacgacctcctacaaaagctcatcacgcccgatcttaccaagcga
ctgggcaatctgcacggcggcagcaaggacgttatgaaccacccctggtttgccgaggtg
acgtgggatcggctacaaaagaaggacattgacgcaccctatgtgccacccgtgcgagct
ggtgttggtgatgccagtcagttcgataagtatccggaagagacggaggcatatggtcag
gcaggggacgacccccacggacacctgtttcccgacttttaa

DBGET integrated database retrieval system