KEGG   Pyrenophora teres: PTT_13132Help
Entry
PTT_13132         CDS       T01613                                 

Definition
hypothetical protein
Organism
pte  Pyrenophora teres
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 453 aa AA seqDB search
MAESSFKQKTMKRKNVKGLALSAPPPKPAPSAGDAQIPGARANDERQDTLEIGVEFQLDL
KAEDLIVLRELGSGNGGTVSKVQHAATKVIMARKVIHVEAKNEVRKRIVRELRIMHDCNS
DYIVDFYGAFQNSSGDVIMCMEYMDVGSLDWVSRTFGPVRVDVLGKISEAVLGGLAYLYS
AHRIMHRDLKPSNILVNSKGNIKLCDFGVSSELEGSIAETFVGTGTYMAPERIQGSPYTV
KSDVWSVGLTLMELAIGKFPFAGSGDDDEAGGPQGILDLLQQIVLEPSPKLPKSDAFPSI
LEDMIAKCLMKDPAERPTPKELYEHDAFLQAAKRTPVDLEAWAISMIEHNKRKSHLAPAA
PAATIKEKLRERSPPSKRDSNDPRQRVANGDSDAAPRRPSQSSRTNSTSSVNVMNLPMRP
APPVDGPGSRPGSRGPAANGLPAQPRRWNNEVQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatcatccttcaagcagaagacgatgaagaggaagaatgtaaagggactcgca
ctcagcgccccaccgccaaagccggcgccctccgctggagacgcccaaatacccggcgcc
cgcgccaacgacgagaggcaggacacgctggagattggcgttgaatttcaactagatctt
aaggcagaagacctgatagtactacgggaactgggatccggtaatggaggaacagtgagc
aaggtgcagcacgctgctaccaaagtcatcatggcgaggaaggttatacacgtcgaagca
aagaacgaagtacggaaacgaatcgtgcgagaactgcgcatcatgcacgactgcaactcg
gactacattgtagacttttacggcgcttttcaaaattcgtccggggacgtgataatgtgc
atggagtacatggatgtgggttcccttgactgggtttctcgaacatttggacccgtccgc
gtggacgtgcttggaaagatctcagaggccgtcctcggcggtcttgcctacctctacagc
gctcaccgcatcatgcaccgcgatctcaagccttcgaacatcctcgtaaactcaaaggga
aacatcaagttgtgcgatttcggtgtatcgagtgagctggaagggtctattgctgagaca
tttgtgggtacaggtacatacatggcgccggagcggatacaaggatctccctataccgtt
aaatcggatgtatggagtgtaggtctcacattgatggagctggccatcggaaagttcccc
tttgcggggagcggagacgacgacgaggcgggcggtccccagggtatcctcgatctccta
cagcagattgttctggagccttcaccaaagctacccaagagcgacgccttcccatcgatc
ctagaggatatgattgcaaagtgtttgatgaaggacccggcggagcgaccaactcccaag
gaactatacgaacacgacgccttccttcaagccgccaaacgcacccccgtcgacctcgag
gcatgggccatatccatgatcgaacacaacaagcgcaaatcccatctcgcccctgccgca
cccgccgctaccatcaaagagaagctccgcgagcgatcacccccctccaagcgtgattca
aacgacccaagacaaagagtcgcaaatggcgactcggatgccgctccccgccgtccttca
caatcctcccgcacaaacagcacgtctagcgtcaacgtcatgaacctgcctatgcggccg
gcgccgcctgtcgatggccctggctcaagacccggctcaagaggccccgcagcaaatggg
ctacctgcgcagcccaggaggtggaataacgaagtgcaataa

DBGET integrated database retrieval system