KEGG   Pyrenophora teres: PTT_13132Help
Entry
PTT_13132         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pte  Pyrenophora teres
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pte00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PTT_13132
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PTT_13132
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PTT_13132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 453 aa AA seqDB search
MAESSFKQKTMKRKNVKGLALSAPPPKPAPSAGDAQIPGARANDERQDTLEIGVEFQLDL
KAEDLIVLRELGSGNGGTVSKVQHAATKVIMARKVIHVEAKNEVRKRIVRELRIMHDCNS
DYIVDFYGAFQNSSGDVIMCMEYMDVGSLDWVSRTFGPVRVDVLGKISEAVLGGLAYLYS
AHRIMHRDLKPSNILVNSKGNIKLCDFGVSSELEGSIAETFVGTGTYMAPERIQGSPYTV
KSDVWSVGLTLMELAIGKFPFAGSGDDDEAGGPQGILDLLQQIVLEPSPKLPKSDAFPSI
LEDMIAKCLMKDPAERPTPKELYEHDAFLQAAKRTPVDLEAWAISMIEHNKRKSHLAPAA
PAATIKEKLRERSPPSKRDSNDPRQRVANGDSDAAPRRPSQSSRTNSTSSVNVMNLPMRP
APPVDGPGSRPGSRGPAANGLPAQPRRWNNEVQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatcatccttcaagcagaagacgatgaagaggaagaatgtaaagggactcgca
ctcagcgccccaccgccaaagccggcgccctccgctggagacgcccaaatacccggcgcc
cgcgccaacgacgagaggcaggacacgctggagattggcgttgaatttcaactagatctt
aaggcagaagacctgatagtactacgggaactgggatccggtaatggaggaacagtgagc
aaggtgcagcacgctgctaccaaagtcatcatggcgaggaaggttatacacgtcgaagca
aagaacgaagtacggaaacgaatcgtgcgagaactgcgcatcatgcacgactgcaactcg
gactacattgtagacttttacggcgcttttcaaaattcgtccggggacgtgataatgtgc
atggagtacatggatgtgggttcccttgactgggtttctcgaacatttggacccgtccgc
gtggacgtgcttggaaagatctcagaggccgtcctcggcggtcttgcctacctctacagc
gctcaccgcatcatgcaccgcgatctcaagccttcgaacatcctcgtaaactcaaaggga
aacatcaagttgtgcgatttcggtgtatcgagtgagctggaagggtctattgctgagaca
tttgtgggtacaggtacatacatggcgccggagcggatacaaggatctccctataccgtt
aaatcggatgtatggagtgtaggtctcacattgatggagctggccatcggaaagttcccc
tttgcggggagcggagacgacgacgaggcgggcggtccccagggtatcctcgatctccta
cagcagattgttctggagccttcaccaaagctacccaagagcgacgccttcccatcgatc
ctagaggatatgattgcaaagtgtttgatgaaggacccggcggagcgaccaactcccaag
gaactatacgaacacgacgccttccttcaagccgccaaacgcacccccgtcgacctcgag
gcatgggccatatccatgatcgaacacaacaagcgcaaatcccatctcgcccctgccgca
cccgccgctaccatcaaagagaagctccgcgagcgatcacccccctccaagcgtgattca
aacgacccaagacaaagagtcgcaaatggcgactcggatgccgctccccgccgtccttca
caatcctcccgcacaaacagcacgtctagcgtcaacgtcatgaacctgcctatgcggccg
gcgccgcctgtcgatggccctggctcaagacccggctcaagaggccccgcagcaaatggg
ctacctgcgcagcccaggaggtggaataacgaagtgcaataa

DBGET integrated database retrieval system