KEGG   Pyrenophora teres: PTT_13451Help
Entry
PTT_13451         CDS       T01613                                 

Definition
(RefSeq) hypothetical protein
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pte  Pyrenophora teres
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PTT_13451
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PTT_13451
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PTT_13451
Lipid biosynthesis proteins [BR:pte01004]
 Desaturase
  First
   PTT_13451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 206 aa AA seqDB search
MGEGYHNFHHEFPSDYRNAIVWYQYDPTKWLIWAFSKIPLFPLAYDLKTFRSNEIEKGRL
QQQQKALDKKRSGLDWGAPLAQLPVIPWDDFQTQSSANGAALVAIAGVIHDVSPFIADHP
GGKALIKSAIGKDATAIFNGGVYEHSNAAHNLLSTMRVAILRGGQEVEVWKRTTERAVKD
SETFGIVRASDQVTRITEPVAVAVAA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaggctatcacaacttccaccacgagtttcccagtgactatcgtaacgcgata
gtttggtaccagtacgatcctaccaaatggctcatctgggccttttcaaagatcccgtta
tttccattagcctacgatctgaagacatttcggtccaacgaaattgaaaaaggccggctg
cagcagcagcaaaaggctctcgacaagaagcgatcgggactggactggggtgctccgcta
gcccagctacctgtcatcccctgggatgacttccaaacccagtcctccgctaacggagct
gctttagtcgctattgccggagtgatccacgatgtctcccctttcattgcggatcatcca
ggcggcaaggcactcatcaagtctgcaatcggaaaggatgcgactgcaatattcaacggc
ggtgtgtatgagcattcgaatgcggcacataacctgctttcaacgatgcgcgtagcgatc
ctcaggggcggtcaagaagtcgaggtttggaaaagaacgaccgaaagagcagtgaaagat
tcagagacctttggtatagtaagggccagtgatcaggttacgaggatcactgagccggtg
gctgttgcagttgcagcgtga

DBGET integrated database retrieval system