KEGG   Pyrenophora teres: PTT_13464Help
Entry
PTT_13464         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PTT_13464
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PTT_13464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 890 aa AA seqDB search
MEPQWTAYSDTPGARYSHSMASPQHAPRDASVASHMKPDAYATPSRQSSMALQSPAGPGT
RGPEYNDGDGDVPMEDAYKPRLNVTRPSQTQRQSQQYLQQAEESTAARRYSPMNLSPTSP
YSGSTPQGGQSYTSFTPQTQAQSQSNRQSPTRNNPYMSPPNSYYSPPSSRPNAPQLPPIQ
SNMSPDSYYPQSATAQLNAVYNREASSPRATSSSNAQQLSPLPVGRGPVPKFEKCVNTAD
LRPKINTQPPFRRANPEGGFISPLQALTAHLPMTYKLCNGGFNYQSSRNPRRVLTKPSKG
VKNDGYDNEDSDYILYVNDILGSEESGHKNRYLILDVLGQGTFGQVVKCQNLKTQEVVAV
KVIKNRTAYFNQSMMEVSVLDLLNKQMDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLY
ELIKQNQFRGLSTTLVRVFAQQLINGLALLGKAKLIHCDLKPENILLKNLESPIIKIIDF
GSACDERQTVYTYIQSRFYRSPEVLLGLPYSAAIDMWSLGCIVVELFLGLPLFPGSSEYN
QVSRITEMLGLPPHWMLEMGKQSGEFYEKSQDEYGRKQYRLKSMEQYSREHGTKEQPSKK
YFSATTLPDIIKNYPMPRKNMKPNEIEREMANRAAFIDFAQGLLNLNPLERWTPAQAKLH
PFITQAKFTGPFVPPMTLKSGSSRSPAPGVQEQQRYEGMSRQRQQQQQQAVAQQQQAQAA
QHAAYANMQMNQYAAAQSPQAQQNPYNMYNPNHQAAPPPYPAQAAQYAQPMNMMQPQQPR
QYNQPQNLYAQATTRAGRQRATTMDQQQSGQSGIPPALQRVMSHLDPNAPVRLQPSPAYY
PPPPDGAPESASSARRRGSRAGNSNRNHNFVRNLEDRTLEEGFMGQNHWQ
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcagtggacggcctattccgacactccaggcgcacgctattcgcacagcatg
gcctccccgcagcacgccccgagggacgccagcgtggcctcgcacatgaagcccgacgcc
tacgcaaccccgtcccgccagagctcaatggccctgcaatcgcccgccggcccaggcacc
cgcgggcccgagtacaacgacggcgatggcgacgtgcccatggaggatgcctataagccg
cgcctaaacgtgacgcgacccagccagacgcagcgccagtcacagcagtacctgcagcag
gcggaagagagtacagccgcgcggagatactcgcctatgaacctctcccccacatcgcca
tattcgggctccacgccgcagggcggccagagctacaccagctttaccccacagacccaa
gcccagtctcagagcaacagacagagcccgacacgcaacaacccctacatgtcaccgccg
aatagctactactccccgccatcctcgcgcccgaatgcgccccaactgccacccatccag
tccaacatgagccccgacagctactacccacagtctgccacggcgcaattgaacgccgtc
tacaacagagaggcctcctcgccgcgcgcaacctcgagctcgaatgcccagcaattgtcc
cccttacccgtagggcgaggacctgtgcctaaattcgaaaagtgcgtcaatacagccgac
ctacggcccaagatcaacactcagccgccgttccgtcgtgccaaccccgagggtggattt
atcagccctctgcaagcgcttactgcgcacctccccatgacgtacaagctatgcaacggc
ggattcaactatcagtcgtcgcgcaacccccgccgagtcctcaccaagccgagcaaggga
gtaaagaacgacggatacgacaatgaggacagtgattacatcctctacgtcaacgatatc
ctggggtcggaagagtcaggccacaagaaccgctacctgattttggatgttctaggccag
ggcacattcggacaggtcgtcaagtgccagaacttgaagacgcaggaagtcgtggccgtc
aaggttatcaagaaccggacagcatatttcaaccagagtatgatggaggtgtcagtccta
gatttgctgaacaagcaaatggacaaaaatgacgaccatcacctgctaaggctcaaggat
accttcatccacaggcaacatctgtgcttggtgttcgagttgctgagtgtcaacctctat
gagctaatcaagcagaaccagttccgtggactatctacaaccttggtgcgcgtcttcgcc
cagcagctaatcaacggtctggcattgcttggcaaggcaaagctcatacattgcgatttg
aagccagagaatattctcctcaaaaacctcgagagcccaatcatcaagattatcgatttc
ggttcggcatgcgacgagcgccaaacagtgtacacgtacatccagtcgcgattctacaga
tcccccgaggtcttgctcggtctgccatattctgctgcgattgacatgtggtcattgggc
tgcattgttgtggagctgttcctgggtctgccattgttcccaggttcttccgaatacaac
caggtctcgaggataacagaaatgctcggactgccaccacactggatgctagagatgggc
aagcagtcgggagagttttacgagaagtcacaggacgagtatggccgcaaacagtaccgg
ttgaagtcgatggaacagtattcgcgcgaacacggcaccaaggagcagcccagcaagaag
tacttttcggccaccactctaccagacatcatcaagaattaccccatgccgcgcaagaac
atgaagccaaacgaaatcgagagagaaatggccaatcgagccgcattcattgatttcgct
caaggactgctcaacctcaatcccttggaacgatggaccccggcgcaagccaagttgcac
ccgttcatcacacaggccaagttcactgggccgtttgtgcccccaatgaccctcaagtca
ggctcgagcaggtccccagcacctggtgtccaagaacagcagcgatacgagggcatgagc
agacagcggcaacagcagcagcaacaagctgtggcgcaacagcaacaagcgcaagcagcc
cagcatgctgcatatgcaaacatgcagatgaaccaatatgctgccgcacaaagcccgcag
gcccagcaaaacccctacaacatgtataacccgaaccaccaagccgcacctccaccttac
cccgctcaagctgcacagtatgctcaaccgatgaacatgatgcaaccacagcagccgcgc
caatacaaccagccccagaacctgtatgcgcaggctactacccgtgctgggcgacaacga
gcaacgacaatggaccagcaacagtccggtcagtcgggtattccacccgcgctccagcgg
gtcatgagccatctggatcccaatgcgcctgtccgtctacaaccatcgccagcttactat
ccgccacctcctgatggtgctccggaaagtgcgagtagcgccaggagacgaggatcacgg
gcaggaaactcgaaccgcaaccacaactttgtgcgaaatctggaggaccgtacgctagaa
gagggtttcatgggtcagaaccattggcagtga

DBGET integrated database retrieval system