KEGG   Pyrenophora teres: PTT_13893Help
Entry
PTT_13893         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pte  Pyrenophora teres
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTT_13893
Enzymes [BR:pte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PTT_13893
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTT_13893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 697 aa AA seqDB search
MDLNSASANSTMSDTPGQVPNDGTGIIQMDGYLEPFKDALKSRFSKAQKWIKTIEETEGG
MEKFSRGYEKFGFNVQSNGDVVYREWAPNALRAYLIGDFNNWDRDATPMTKNDFGVFEVT
VPGKDGQPTIPHDSKIKVSFVVPNDHARQERLPAWITRVTQDLNVSPVYDARFWNPPQKY
VWKNERPPKPQSARIYEAHVGISSPEPKVATYKEFTQNILPRIKHLGYNTIQLMAVMEHA
YYASFGYQINSFFAASSRYGFPDDLKELIDTAHGMGITVLLDMVHSHASKNVLDGLNMFD
GSDHLYFHEGAKGRHELWDSRLFNYGHHEVLRFLLSNLRFWMEEYHFDGFRFDGVTSMLY
THHGIGTGFSGGYHEYFGNSVDEEAVVYLMIANELLHTLYPSSITIAEDVSGMPGLCVAL
SLGGIGFDYRLAMAVPDLYIKWLKEKQDIDWDMGALVHTLTNRRHGEKTIAYAESHDQAL
VGDKTLLFWLCDAQMYTNMSVLSELTPVIDRGLSLHKLIRLITHGLGGEGYLNFEGNEFG
HPEWLDFPREGNNNSFHYARRQFNLPDDELLRYRFLNEFDSKMQWTEEKYGWLHSPQAYV
SLKHEGDKVIVFERAGLLWIFNFHPQNSFTDYRVGVEQEGTYRIVLSTDSKAFGGHGNVD
ETTRFFTTPFAWNERKNFLQVYIPCRTAIVLALESTL
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaacagcgcttcagcgaactcgaccatgagcgacaccccggggcaggtcccc
aacgatggaactggcatcattcagatggatggctacctcgagccgttcaaggacgcactc
aagagccgcttctccaaggctcagaaatggatcaagacgattgaagagaccgagggcggc
atggagaaattctcgcggggttacgagaagttcggcttcaatgtccagtccaacggtgac
gtcgtataccgcgagtgggccccgaatgccctccgcgcctacctcattggtgacttcaac
aactgggaccgcgatgcgacgcccatgaccaagaatgactttggtgtcttcgaggtcact
gtgcctggcaaggacggacagcccaccatcccccacgactccaagatcaaggtgtccttt
gtcgtccccaacgaccatgctcgccaggagcgccttcccgcctggatcacccgcgtgacc
caagacctcaatgtctcccccgtatacgatgcccgcttctggaaccctccccagaagtat
gtatggaagaacgagaggccaccaaagccccagagtgcgcgcatctacgaggcccacgtt
ggtatctcatcgccagagcccaaggtagccacttacaaggagtttacccaaaacatccta
ccccgcatcaagcacttgggatacaacactatacaattgatggcggtcatggagcatgcc
tactatgccagtttcggatatcagatcaatagcttctttgcggcgagtagtcgctatggc
ttcccagatgacctaaaggagctcattgatactgcgcacggcatgggtatcactgtgctg
ctggatatggtgcacagccacgcatccaagaacgtgctcgacggtctgaacatgttcgac
ggaagcgaccacttgtacttccacgagggcgccaagggacgacatgagttgtgggacagc
agactgttcaactacggccaccacgaggttctgcgcttcctgctcagcaacctgcgtttc
tggatggaggagtaccactttgatggtttccgattcgacggtgtcaccagcatgctgtac
actcaccacggtattggaacgggtttctcgggtggttaccacgagtactttggtaattct
gtagacgaggaggctgttgtatatctcatgatcgccaacgagctgctgcacacgctctac
ccatcttccatcacaattgcggaagatgtgtcgggtatgcccggtctttgtgtggcactc
tcgctcggtggaataggattcgactacagattagccatggctgtacctgacctctacatc
aagtggctgaaggagaagcaggacattgactgggacatgggtgctctcgtccacaccctg
acaaacaggcggcatggcgagaagaccattgcgtacgccgagagtcacgaccaagcgctc
gttggtgacaagacactactcttctggctttgcgacgcacaaatgtacaccaacatgtcc
gttttgtcggagctgacgcctgtgattgaccgaggtctgtctctgcacaaactgatccga
ttgatcacacacggtcttggtggtgagggctacctcaactttgagggcaacgagtttggt
cacccagaatggctcgacttccctcgagagggcaacaacaacagcttccactacgcccgc
cgtcaatttaacctcccagacgatgagcttctccgctacaggttcctcaacgagttcgac
agcaagatgcaatggacagaggagaagtacggatggctgcactcgccccaggcctacgtc
agtctcaagcacgagggtgacaaggtcattgtgtttgagcgtgctggtcttctctggatc
ttcaacttccacccccagaacagcttcactgattaccgcgttggtgtagagcaggagggt
acttaccgtatcgtcctgagcacagacagcaaggcttttggtggtcatggaaatgtcgat
gagacgacaaggttcttcaccacgccatttgcgtggaacgagaggaagaacttcttgcag
gtctacattccctgcaggaccgccatcgtccttgctctggagagcactttgtag

DBGET integrated database retrieval system