KEGG   Pyrenophora teres: PTT_13990Help
Entry
PTT_13990         CDS       T01613                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pte  Pyrenophora teres
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PTT_13990
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTT_13990
   00640 Propanoate metabolism
    PTT_13990
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PTT_13990
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PTT_13990
Enzymes [BR:pte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PTT_13990
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PTT_13990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 2279 aa AA seqDB search
MAGAATNGVNGDANGAPSSYAAKYDLAPHFIGGNNLRVASPGKVKDFVAAHDGHTVITNV
LIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLQANAEYIRMADQYVEVPGG
TNNNNYANVELIVDVAERMNVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAMRS
LGDKISSTIVAQHAKVPCIPWSGTGVDEVQVDANGIVTVEDHIYEKGCTKSWQEGLEKAK
AIGFPVMVKASEGGGGKGIRKVEREEDFEQLYKAAASEIPGSPIFIMKLAGSARHLEVQL
LADQYGNNISLFGRDCSVQRRHQKIIEEAPVTVAGSKIFQEMEKAAVSLGRLVGYVSAGT
VEYLYSHSDDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGLPLHRVRDIRLLYG
ADPHASSVIDFDFSTEGSAKSQRRPTPKGHCTACRITSEDPDEGFKPSGGTIHDLNFRSS
SNVWGYFSVSSAGGIHSFSDSQFGHIFAYGENRQASRKHMVVALKELSIRGDFRTTVEYL
IKLLETPAFEDNTITTGWLDELISKKLTAERPDTMIAVICGAVTKAHVASEACIGEYKAG
LEKGQVPSKDVLKTQFPIDFIYDGFRYKFTATKSTIDSFTLFINGTKCSVGVRALADGGL
LILLSGKSHNVYWKEEVGATRLSVDGKTCLLEQENDPTQLRTPSPGKLVRFLVENGDHVD
KGQPFAEVEVMKMYMPLIAQEAGMVNLIKQPGATLEAGDILGVLALDDPSKVKSAQNFTG
QLPDLGAPQVPGAKPPQRFVYLYYILQNIFQGFDNQVIMQSTLKELVDVLRDPELPYGEW
NAQASALHARMPQKLDATFSQIVDKAHSRNLEFPGKALNKAFQKFVEDNVAKGDVAILKA
ALEPLSDVINRYSEGLKAHEYSVMIKLLEMYWAVESLFSSRTSRDEEVILKLRDENRDNI
MSVVQTVLSHTKVGAKNNLVIAILDLYRPNKPGVGNIAKYFKDTLKKLTELESRQTAKVS
LKAREVLIQCAMPSLEERTSQMEHILRSSVVESRYGESGWDHREPNFDVIKEVVDSRYTV
FDVLTQFFVHTDPYVALAALEVYTRRAYRAYHVQNINYHNEGEQQCFLSWDFILRKVGEA
EYGLAVEPSEPGTPSTPGFERPPRIQSLSDMTAWNNRFEGEPSRKGVVVPVEYLDDADEL
ISKALDIFPNVGKERKGGIGLREGLTMKRTPTTGVNEPKHTDELTGVINVAVRDIEGNDD
KEILERILPIVEDYKTELLSRRIRRISFICGHKDGTYPGYYTFRGPNYEEDASIRHVEPA
LAFQLELGRLSKFDIKPVFTENRNIHIYEAVGKGAESDKRYFLRAVVRSGRLREEIPTAE
YMVSETDRLMTDILDALEIVGTSQADMNHIFINFSHVFPLNPTEVEEAIGGFLERFGRRL
WRLRVTGAEIRIIVTDPATGIPYPLRVIITNTSGYVIQVEMYAERKSEKGGKWLFHSIGG
TTKIGALHLQPVSTPYPTKGALQPKRYKAHLMGTQYVYDFPELFRQATENSWIQAIQKHS
HLRDKQPAKGECMEYYELVLDDTDNLAEVNRDPGQNNIGMVGWMVTAKTPEYPRGRRFII
IANDITYKIGSFGPAEDNFFHKCSELARKLGIPRIYLSANSGARIGLAEELIPHFSVAWK
DASKPEAGFDYLYLTPEKYEHFVDGKRNDVICEKVELDDETRYKITTIIGAEDGLGVESL
RGSGLIAGETSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAQAINKL
LGREVYTSNLQLGGTQIMYRNGVSHSTADDDFEGVSKIVQWMSYVPDKKGSPVPISPSAD
NWDRDITYYPPGKSAYDVRHLIAGKEDEDGFQSGLFDRGSFVETLGGWAKTVVVGRARLG
GIPIGVIGVETRSVENVTPADPANPDSIEQVTSEAGGVWYPNSAFKTAQAIKDFNNGEQL
PLMILANWRGFSGGQRDMYNEVLKYGSYIVDALVKFEQPIFIYIPPYGELRGGSWVVVDP
TINPQFMEMYADEDSRGGVLEPEGIVGIKYRRERQLDTMARNDPTYAELKRKLNDKITPE
ADLQGIKAEMTEREKKLLPIYGQIAIQFADLHDRAGRMQAKGVIRQALRWQNARRFFYWR
LRRRLNEEYILKKFAAAASPTHDNPMANPLTRSRGFEMLKHLANVPNWETDDMTVATWYE
ENRPLVSEKIEQLKTDGIATEIAQLMRKDREGGLKGVMSLLSTLPTTEKEEVLKMLSRA
NT seq 6840 nt NT seq  +upstreamnt  +downstreamnt
atggccggagctgcaaccaacggagtcaatggggatgctaatggcgccccgagctcatac
gcagccaagtacgatcttgctccgcatttcatcggcggcaacaacctccgcgtagcatca
ccaggcaaggtcaaggactttgtcgcggcgcacgatggacacacagtcattacaaatgtt
ctcattgcgaacaacggtatcgccgccgtcaaggaaatccgctctgtgcgaaaatgggca
tatgagacttttggcgatgagcgggcgattcagttcaccgtcatggccacgcctgaggat
ttgcaggcgaacgccgagtacatccgcatggcagaccaatacgttgaggtacccggcggt
accaacaacaacaactacgccaacgtggagcttattgtcgatgtggccgaacggatgaac
gtgcacgccgtatgggcaggatggggacacgcctcagaaaacccaaagctgcccgaatcg
ctcgccgcttcgcccaagaagatcgtcttcattggtcccccgggatctgccatgcgctcg
cttggtgacaagatctcgtccacaatcgtcgcacaacacgcaaaggtgccatgtatccca
tggtcgggaacaggcgtcgacgaggtgcaggttgacgccaacggcatcgtcacagtcgaa
gaccacatctacgagaagggctgcacaaagtcatggcaggagggtctcgagaaggccaag
gccattggcttccccgtcatggtcaaggcctcagaaggtggtggcggcaagggtatccga
aaagtcgagcgcgaggaggactttgagcagctgtacaaggccgctgcctcagaaattccc
ggatcgcccatcttcatcatgaagcttgcaggcagcgcccgccatctggaagtccagctg
ctggctgaccagtacggcaacaacatctccctgtttggacgtgattgttcggtacagcgt
cgtcaccagaagatcattgaagaggcaccggtaacagttgctggctcaaagatcttccag
gagatggagaaggctgccgtctcgctcggacggctagttggatacgtctctgccggtaca
gtcgagtacctctactcgcactctgacgacaagttctacttcctcgagttgaaccctcgt
cttcaggtagagcatcccaccacggaaatggtaacgggcgtgaacctcccagccgcccaa
ctccagattgccatgggtctcccattgcaccgtgttcgcgatattcgactactgtacggc
gccgacccccacgccagctctgtgattgacttcgacttctccaccgaaggcagcgccaag
agccagcgtcgccctactcccaagggccactgcacagcctgccgtatcacctcagaagat
cccgatgagggcttcaagccttccggcggtaccattcacgacctcaactttaggagtagc
tccaacgtatggggttacttctccgtcagctccgctggtggtatccacagcttctctgat
tcccaatttggtcacatcttcgcttatggcgagaaccgacaggcatcacggaaacacatg
gttgtcgcgctcaaggaattgagcattcgcggtgacttccgaacaaccgtcgaatatctc
atcaagctgctcgagacgcctgcgttcgaggacaacaccatcacaactggctggcttgac
gagctcatctccaagaagctgactgccgagcgaccggataccatgatcgctgtcatttgc
ggtgccgttaccaaggctcatgtcgcaagtgaagcgtgcattggcgagtacaaggcaggt
ctggaaaagggtcaggttccgtcgaaggatgtgctcaagacccagttcccaattgacttc
atctacgacggtttccgatacaagtttactgctacaaagtcgaccatcgacagcttcaca
ctcttcatcaacggaaccaagtgttccgtcggtgtcagggcgcttgccgatggtggtctc
ttgatcctgctcagcggcaaatctcacaacgtctactggaaggaagaagttggcgctact
cgtctctctgttgatggcaagacatgccttctcgagcaagagaatgaccctactcaactc
cgaacgccatcccctggtaagctcgtccgtttcttggtcgagaacggcgatcacgttgac
aagggccagccctttgccgaggttgaggtcatgaagatgtacatgcctttgattgcccaa
gaagcgggtatggtcaacctcattaagcagccgggagccactctcgaagctggtgatatc
ctcggtgtcctagccttggatgatccttccaaggtcaagtcagcccagaactttaccggt
cagcttcccgacttgggtgccccacaagtaccaggagccaagccaccgcagaggttcgtc
tacctgtactacattctccagaacatcttccagggtttcgacaaccaggttatcatgcag
agcactctcaaggaactggtcgacgtcctccgggatcctgagctgccttatggcgagtgg
aatgcacaggcttctgctcttcacgcacgtatgccgcagaagctcgatgcaaccttctcc
caaattgtagacaaggctcacagccgcaacctcgagttcccaggaaaggcactcaacaag
gctttccagaagtttgttgaggacaatgtagccaagggcgatgttgcgatcctcaaggcc
gcattggagcccctctctgatgtcatcaaccgttactctgagggcctcaaggcacacgag
tacagtgtcatgatcaagcttctggagatgtactgggctgttgaatcgctcttctcatcc
cgcacttcgcgtgacgaggaggtcatcctcaagcttcgtgacgagaaccgcgacaacatt
atgagcgttgtgcagactgtcctttctcataccaaggttggtgcaaagaacaacctagtc
attgccatcctggatctctaccgacccaacaagcctggtgttggaaacatcgccaagtac
ttcaaggacactctcaagaagcttactgagcttgagtctaggcagactgccaaagtctcc
ctcaaggctcgtgaggtcctcattcaatgcgccatgccctcgcttgaggagcgcacctcg
caaatggagcacatcttgcgctcttctgtcgttgagtctcgctatggtgagagcggctgg
gaccaccgtgagcccaacttcgacgtcatcaaggaggtcgtggactctaggtacactgtc
ttcgacgtgttgacccagttcttcgttcacaccgacccatacgtcgcccttgctgctctt
gaggtgtacactcgccgagcctaccgtgcgtaccatgtccagaacatcaactaccacaac
gaaggcgagcagcagtgcttcctctcttgggacttcatccttcgcaaggtcggcgaggca
gagtacggccttgctgtcgagccatcagagcccggtacccctagcactccaggattcgag
cgccctcctcgcatccagtcactaagtgatatgactgcttggaacaaccgtttcgagggc
gagccttctcgtaagggtgttgttgtgcctgttgagtaccttgacgatgcggacgagctt
atcagcaaagccctagacatcttccccaacgtcggcaaggaaaggaagggcggcattggc
ttgagggaaggcctcaccatgaagcgcactcccaccacaggtgtcaacgagcccaagcac
accgacgagcttacgggtgtcatcaacgttgctgttcgcgacattgagggcaacgacgac
aaggagatccttgagcgcatcttgcccatcgtcgaggactacaaaaccgagctcctatct
cgccgcattcgtcgcatttctttcatctgcggtcacaaggacggaacctaccccggatac
tacaccttccgtgggcctaactacgaggaagacgccagtattcgtcacgtcgaacccgct
cttgccttccagcttgaacttggtagactttccaagttcgacatcaagcccgtctttacc
gagaaccgcaacatccacatctacgaggctgtgggcaagggcgccgagagcgacaagcgc
tacttcttgagggctgtcgttcgatcaggccgtcttcgagaggagattcctaccgccgag
tacatggtgtcggagactgacagattgatgactgatattctagatgctctggagattgtt
ggcacttcgcaggctgacatgaaccacatcttcatcaacttctcgcacgtcttcccgctt
aaccctacggaggttgaggaagccattggtggtttcttggagcgctttggtcgacgactc
tggcgtcttcgcgtgactggcgctgagattcgcatcattgtcactgaccccgccactggc
atcccataccctcttcgtgtcatcatcaccaacacctccggatacgtcatccaggtcgag
atgtatgctgagcgcaagtctgagaagggtggcaagtggctcttccacagcattggtgga
accaccaagattggtgcgcttcacctccagccagtctccactccttatcctaccaagggt
gctctgcagcccaagaggtacaaggcccatctcatgggtacccaatacgtctacgacttc
cccgagctcttccgacaagcgacggagaacagctggatccaggctattcagaagcattct
catcttcgcgacaagcagcctgcgaagggagagtgtatggagtactacgagttggtgctt
gatgatactgacaacctggccgaagtgaaccgtgaccctggtcaaaacaacatcggcatg
gttggttggatggtcactgctaagacacctgaataccctcgtggccgccgcttcatcatc
atcgccaacgatatcacctacaagattggttcattcggacctgcggaagacaacttcttc
cacaaatgctcagagcttgcacgcaagctcggcatcccacgaatctacctttcggccaac
tctggtgctcgcattggtctggctgaggagcttattccccacttctccgttgcatggaag
gatgctagcaagcctgaggctggtttcgactacctgtacctcacgcctgagaagtacgag
cacttcgtcgatggaaagcgtaacgatgtcatctgcgagaaggtcgagctggatgacgag
acgcgctacaagatcaccactatcatcggtgctgaagatggtcttggtgttgagtccctt
cgtggctctggtctcattgctggtgagacgtcgagggcttatgaagacattttcaccatc
accttggtcacttgtcgctcagtcggtattggtgcctacctagtccgtctcggccagcgt
gccatccagattgagggccagccgatcattctcactggtgcacaggctatcaacaagctt
cttggtcgtgaggtgtacacctccaacctccagcttggtggtacccaaatcatgtacagg
aacggtgtctcgcattccactgccgatgacgacttcgagggtgtttccaagatcgtccag
tggatgtcatatgtacccgacaagaagggcagccctgttccgatctcgccgtcggccgac
aactgggaccgagacatcacctactacccccctggcaagtctgcctatgatgtcaggcat
ctcattgccggaaaggaggatgaggatggcttccagtcgggtctcttcgatcgcggttcg
tttgtggagactcttggtggttgggctaagactgtcgtcgtcggtcgtgctcgtcttggc
ggcatccctatcggtgtcattggcgttgagacccgctcggttgagaacgtcacccctgct
gatcctgccaaccccgactccatcgagcaagtcacatccgaggctggtggtgtgtggtac
cccaactctgctttcaagactgcacaggccatcaaggatttcaacaacggtgagcaactg
ccgctgatgatccttgccaactggcgtggtttctctggtggtcaacgcgacatgtacaac
gaagtcctcaagtacggttcgtacattgtcgatgctcttgtcaagttcgagcagcccatc
ttcatttacattcccccgtacggcgaacttcgcggtggatcatgggtcgtcgtcgatcct
accatcaatccgcagttcatggagatgtacgctgacgaggattcgcgtggtggtgttctc
gagcccgaaggtatcgtcggtatcaagtaccgtagggagcgtcaactcgacaccatggct
cgcaacgaccctacctatgctgagctcaagcgcaagctgaacgacaagatcacacctgaa
gccgaccttcagggcatcaaggccgagatgactgagcgcgagaagaagcttctgcccatc
tatggtcagattgctatccaattcgccgacctgcacgaccgcgccggacgtatgcaagcc
aagggcgtcattcgacaagctcttcgatggcaaaacgctcgccgcttcttctactggcgt
cttcgccgccgtctcaacgaggagtacatcctcaagaagtttgccgcggccgcctcgcca
acacatgacaaccctatggccaacccgcttacccgtagccgtggctttgagatgttgaag
cacctcgccaacgtccccaactgggagactgacgatatgaccgtcgctacctggtatgag
gagaacaggccgctcgtcagcgagaagattgagcaactcaagacggatggaattgcgacg
gagattgcgcaactcatgcgcaaggaccgcgagggtggattgaagggtgtaatgagcttg
ctcagcacactgcctaccaccgagaaggaggaggtacttaagatgctcagccgggcatag

DBGET integrated database retrieval system