KEGG   Pyrenophora teres: PTT_14294Help
Entry
PTT_14294         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pte  Pyrenophora teres
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pte01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pte01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 480 aa AA seqDB search
MPSHQPTAGMMAVDPEYVKQPSPMASTSEPNRNPKYDPKKPHITDTPITKANWYKHVNWL
NVTFIIGIPLAGCVAACFTPLRWQTALWAVVYYFWTGLGITAGYHRLWAHKSYNASLPLS
VFLALVGGGAVEGSIRWWSRDHRAHHRYTDTNKDPYSVRKGLLYSHLGWMVMKQNPKRIG
RTDITDLNEDPVVVWQHKHYIKVVIFMGLIFPSAVAGLLWNDWKGGFIYAGILRIFFVQQ
ATFCVNSLAHWLGDQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDP
TKWSIWLWSKLGLASNLKQFRSNEIEKGRVQQLQKKIDQKRAKLDWGVPLEQLPVIEWDD
YVEQAKNGRGLIAVAGVVHDVTDFINEHPGGKTLIKSGIGKDATAMFNGGVYFHSNAAHN
LLSTMRVGVIRGGCEVEIWKRAQKENKEVNIVKDEQGNPIIRAGNQVTKVAQPMLSASAA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccaccaacctaccgcgggcatgatggctgtggatcccgaatacgtcaagcag
ccgtctcccatggccagcacctcggagccaaaccgcaatccaaagtacgaccctaagaag
ccacacatcaccgacacgcccatcacaaaggcaaactggtacaagcacgtcaattggcta
aacgtcaccttcatcatcggcatccctctcgccggctgcgtcgcggcctgtttcaccccg
ttgcgatggcagacagccctctgggccgtggtatactacttctggaccggcctcggtatc
acggctggctaccatcgtctctgggcgcacaaatcctacaacgcctcgctgcctctcagc
gtcttcctcgctcttgtcggcggcggcgctgttgagggctccatccgctggtggagccgc
gaccaccgtgcccaccaccgctacaccgacaccaacaaggacccctacagcgttcgcaag
ggccttctctacagccatcttggatggatggtcatgaagcagaaccccaagcgcatcggc
cgcaccgacatcaccgacctgaacgaggaccccgtcgtcgtctggcaacacaagcactac
atcaaggtcgtcatcttcatgggtctcatcttcccctctgctgtcgctggactcttgtgg
aacgactggaagggcggctttatctacgccggcatccttcgcatcttcttcgtccagcag
gccaccttttgtgtcaactcgctcgcccactggctcggtgaccagcccttcgacgaccgc
aacagccccagggaccacgtcatcactgcgctcgtcactctcggtgagggctaccacaac
ttccaccacgagttcccctccgactaccgcaatgctatcgagtggcaccagtacgacccc
accaagtggtccatctggctgtggtccaagctcggtctcgcctccaacctcaagcagttc
cgttccaacgagatcgaaaagggccgtgttcagcagctccagaagaagattgaccagaag
cgcgccaagctcgactggggtgtacctcttgagcagcttcctgtcattgagtgggacgac
tacgttgagcaggccaagaacggccgtggcttgatcgctgttgccggtgtcgtccacgat
gttaccgacttcatcaacgagcaccccggtggcaagacgctgatcaagagcggcattggc
aaggacgctactgccatgttcaacggtggtgtctacttccactccaacgctgcccacaac
ctgctctccaccatgagggttggtgtcatccgtggtggatgtgaggtcgagatctggaag
cgcgctcaaaaggagaacaaggaagtcaacatcgtcaaggatgagcaaggcaacccaatc
atccgagccggcaaccaggttaccaaggttgcgcaacccatgctcagcgccagcgcggca
tag

DBGET integrated database retrieval system