KEGG   Pyrenophora teres: PTT_14294Help
Entry
PTT_14294         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pte  Pyrenophora teres
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PTT_14294
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PTT_14294
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PTT_14294
Lipid biosynthesis proteins [BR:pte01004]
 Desaturase
  First
   PTT_14294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 480 aa AA seqDB search
MPSHQPTAGMMAVDPEYVKQPSPMASTSEPNRNPKYDPKKPHITDTPITKANWYKHVNWL
NVTFIIGIPLAGCVAACFTPLRWQTALWAVVYYFWTGLGITAGYHRLWAHKSYNASLPLS
VFLALVGGGAVEGSIRWWSRDHRAHHRYTDTNKDPYSVRKGLLYSHLGWMVMKQNPKRIG
RTDITDLNEDPVVVWQHKHYIKVVIFMGLIFPSAVAGLLWNDWKGGFIYAGILRIFFVQQ
ATFCVNSLAHWLGDQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDP
TKWSIWLWSKLGLASNLKQFRSNEIEKGRVQQLQKKIDQKRAKLDWGVPLEQLPVIEWDD
YVEQAKNGRGLIAVAGVVHDVTDFINEHPGGKTLIKSGIGKDATAMFNGGVYFHSNAAHN
LLSTMRVGVIRGGCEVEIWKRAQKENKEVNIVKDEQGNPIIRAGNQVTKVAQPMLSASAA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccaccaacctaccgcgggcatgatggctgtggatcccgaatacgtcaagcag
ccgtctcccatggccagcacctcggagccaaaccgcaatccaaagtacgaccctaagaag
ccacacatcaccgacacgcccatcacaaaggcaaactggtacaagcacgtcaattggcta
aacgtcaccttcatcatcggcatccctctcgccggctgcgtcgcggcctgtttcaccccg
ttgcgatggcagacagccctctgggccgtggtatactacttctggaccggcctcggtatc
acggctggctaccatcgtctctgggcgcacaaatcctacaacgcctcgctgcctctcagc
gtcttcctcgctcttgtcggcggcggcgctgttgagggctccatccgctggtggagccgc
gaccaccgtgcccaccaccgctacaccgacaccaacaaggacccctacagcgttcgcaag
ggccttctctacagccatcttggatggatggtcatgaagcagaaccccaagcgcatcggc
cgcaccgacatcaccgacctgaacgaggaccccgtcgtcgtctggcaacacaagcactac
atcaaggtcgtcatcttcatgggtctcatcttcccctctgctgtcgctggactcttgtgg
aacgactggaagggcggctttatctacgccggcatccttcgcatcttcttcgtccagcag
gccaccttttgtgtcaactcgctcgcccactggctcggtgaccagcccttcgacgaccgc
aacagccccagggaccacgtcatcactgcgctcgtcactctcggtgagggctaccacaac
ttccaccacgagttcccctccgactaccgcaatgctatcgagtggcaccagtacgacccc
accaagtggtccatctggctgtggtccaagctcggtctcgcctccaacctcaagcagttc
cgttccaacgagatcgaaaagggccgtgttcagcagctccagaagaagattgaccagaag
cgcgccaagctcgactggggtgtacctcttgagcagcttcctgtcattgagtgggacgac
tacgttgagcaggccaagaacggccgtggcttgatcgctgttgccggtgtcgtccacgat
gttaccgacttcatcaacgagcaccccggtggcaagacgctgatcaagagcggcattggc
aaggacgctactgccatgttcaacggtggtgtctacttccactccaacgctgcccacaac
ctgctctccaccatgagggttggtgtcatccgtggtggatgtgaggtcgagatctggaag
cgcgctcaaaaggagaacaaggaagtcaacatcgtcaaggatgagcaaggcaacccaatc
atccgagccggcaaccaggttaccaaggttgcgcaacccatgctcagcgccagcgcggca
tag

DBGET integrated database retrieval system