KEGG   Pyrenophora teres: PTT_14308Help
Entry
PTT_14308         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pte  Pyrenophora teres
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PTT_14308
   00500 Starch and sucrose metabolism
    PTT_14308
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PTT_14308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 305 aa AA seqDB search
MTSFVLNDRPPRHSAIALAAVDALSTTGTAAQCIFIAAGTYKEQVSIQQLASQLTIYGET
TDISSYGSNTVNITQGKSQDDSPNNDATATLRALTTNLNVYNINLINTRGKGRQALALSA
SSDKQAYYGCQFRGFQDTVLAQSGRQLFAQSYIEGATDFIFGQHATAWFEQVSIGVLPAS
LGYITANGRALASDPSFYVINNSTIAAAPGTSVPAGAYYLGRPWGNFARVVFQRTNMTNV
INSLGWASWHKDDPRTDSVTFGEFANTGAGSTGTRASFSQKISAAIPITNILGSDYKNWV
DQTYL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgttcgtcctgaacgaccggccgccgcgtcattccgctattgcactagcagct
gtggatgccttgagcaccaccggcacagcggcacagtgtattttcatcgccgcgggcacc
tacaaggagcaagtctccatccaacaactcgcgtcacagttgactatctacggagaaact
accgatatcagcagctacggctccaacacggtgaatattacccaaggaaagagccaggac
gattcacccaacaatgacgccactgcaacccttcgggcattgactacaaacctcaatgtt
tacaacatcaacttgatcaacactcgcggaaagggcaggcaagctctcgctctcagtgca
tcatccgacaagcaggcctactacggctgccagttcaggggctttcaagacacagtcctt
gcgcaaagcggcagacagctattcgcccagtcttacatcgagggtgccacggacttcatc
tttggccaacacgccacggcctggttcgaacaagtctccattggtgttctccctgcatcg
cttggttatataaccgccaatggtcgtgcgttggcttccgacccttccttctacgtgatc
aacaactccacaatcgccgctgcaccgggcaccagcgttcccgccggtgcatactacctc
ggtcgcccatggggaaactttgctcgcgtcgtattccagagaactaacatgactaacgtc
ataaactctctgggctgggcaagttggcacaaggatgatccgaggacggattcggttacg
tttggggagtttgccaacaccggcgctggatcgaccggcaccagggcaagcttttcccaa
aagatctcggctgctattccgatcacaaatatcctgggcagtgattacaagaactgggtc
gatcagacgtacctgtga

DBGET integrated database retrieval system