KEGG   Pyrenophora teres: PTT_14325Help
Entry
PTT_14325         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pte  Pyrenophora teres
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PTT_14325
Translation factors [BR:pte03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PTT_14325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 255 aa AA seqDB search
MAEVAAAPKGDQQVPLDTIPISPTENSGESKEESTNNTSSEGEIRTVFHDPENFNVKHPL
MNTWTLWFTKPPSGKGDNWAELLKEVISFDSVEEFWGIYNNITPTSDLALKSDYHLFKKG
VRPEWEDSQNKHGGKWAFQFKDKKAINIDALWLHVMLAAIGENLEDEDDNEVMGVVVNVR
RGFYRIGLWTRSVGRAISGEGGKGRTQEQGKEVLLKIGRRFKQALQLKDNDAVEFSGHTD
AAHAGSTRAKAKFSV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttgcagccgcaccaaagggcgatcagcaggttccgctagacacgattccc
atttcgcctacggagaactctggcgagagcaaggaggaatcgaccaacaacacgtcctct
gagggcgaaatccgcaccgtattccatgacccagagaacttcaatgtcaagcacccgctc
atgaacacttggacgctgtggttcaccaagcctccgagtggcaagggtgacaactgggct
gagctactgaaagaggtcatctcgttcgactcagttgaggagttctggggcatctacaac
aacatcacccccacatccgacctcgcgctcaagtctgactatcatctgttcaagaagggt
gtacggcccgagtgggaagactctcagaacaagcacggcggcaagtgggctttccagttc
aaggacaagaaagccatcaatatcgatgcactctggcttcacgtcatgttggccgccatc
ggcgagaacctcgaggacgaggacgacaacgaggtcatgggtgttgtcgtcaacgttagg
cgaggcttctaccgtatcggtctctggacgcgctccgtcggccgtgccatctccggcgag
ggaggcaagggcaggactcaagagcagggcaaggaggttctgctgaagatcggtaggcga
ttcaagcaggcgcttcagctcaaggacaacgacgcggttgagttctctggtcatactgat
gcagctcatgctggcagcactcgcgcaaaggccaagttcagcgtctaa

DBGET integrated database retrieval system