KEGG   Pyrenophora teres: PTT_14357Help
Entry
PTT_14357         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pte  Pyrenophora teres
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pte00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pte00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1082 aa AA seqDB search
MASQTAESVPIPQPPPSLFIGNLSEIDPTNVPSSFQRLADIYGEIYQLDLPGRKGKVVVI
SSYDTINDVCDADRFEKPINATLEEVRALTGNGLFTAYPGEKAWGVAHRLLMPVFGPMGI
RKMFDDMMDIATQMLLRWDRFGPEHEILCSDDFTRLTFDMIGLCAFGYRFNNFYSDHANP
FIDQMVEVLVESGKRSSRTAIENKLRVFAEANRQENVKKMHDLCDHIIADRIAHPQPDAK
DLLNPMLEGVDKETGEKMSKELVRYNMVTFLVAGHETTSGTLGFLFYHLLKNPETYLKAQ
AEVDEVIGDGPLEAKHMSQLVYIKFAIYEALRFLGPIAITAKHSLAPTKIAGKYQVQPED
HVLMNLRGLHHDPKVWGEDAEVFRPDRFLNGGWENLPPNAWKAFGDGMRACIGRTFAEQE
MIMIVALILQKFQVELADPAYQLHVSVTITQKPKDLKIKVRRRPGRTMAGLGGARQNDSP
HKAGTEKSSPSNEANTPTRDAKPITVLYGSNAGTCKSYAEDLETNASRFGFKANIASLDS
ATEHIPKDQPIVIIEPSYEGKPADNAKKFTAWLEGNADSKQLEGVRYAVFGVGNSDWTHT
YHRIPKLTDSLFEKMGAKRFTEIGLVNVKEDIMGPWETWSEQMWNDLRKSSGTTVEVLGG
QVEVHITPPKFATYLGGNDIGYGEVKANKDLGGGEVGLAKKHMEIELPVGTSYRSGDYMV
ILPLNSITNVRRIMKRFDLAPDDNIVVTGTNKSFIATDSPISIFDLLMTRVELSTPISQK
QLQTLAEATPESKRNKLLELATDEVYKRDIISKRYSILDILEDYPDCQLDFATYLDSLKP
LSPRQYSISSSPIANIEFTQKPDGTNTQRLTASLTYDIHEEAAWSGGGRQFRGAASTYLA
RQEPGEKVRCFTRPTNANFHLPLDPTVPIIMICAGSGLAPMRGFIQERAVIKKARNATVG
PAILYFGCRNHEKDFIYADELAQWEADGVVSVRGCFSKVAPEGQKAQRVPDRMWDERKEL
AALFGEQGAKIFICGSASKLAKSTAEVCMKIYMDTFPGKTEDDAQEWLDKVKEDRYVSDV
FE
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcaaacagcagaatccgttccaatccctcagcctccaccctcactgttcatc
ggaaacctttcagagatagaccccaccaatgtgccaagctccttccaacggcttgcagac
atctatggcgagatttatcagcttgatctaccaggtcgcaagggtaaggtcgttgttatt
tcctcatacgacacgataaacgatgtctgtgatgccgatcgattcgagaagcccatcaat
gcaacgctcgaggaggttcgtgccctaactggcaatggtttattcacagcctaccctggg
gagaaggcatggggagtggcacatcgtttgctcatgccagtgtttggcccaatgggcatc
cgcaagatgtttgatgatatgatggatatcgcgacacaaatgctgctccgatgggaccgg
tttggcccagagcatgagatattgtgtagcgacgacttcacacgactgacattcgatatg
atcggcttatgcgcatttggatatcgattcaacaacttctactctgatcatgcaaacccg
ttcattgaccagatggttgaggttttggtggaatctggaaaacgaagcagccgtacagca
attgagaacaaactgcgcgtcttcgctgaagctaatcgccaggagaacgtgaagaagatg
catgatttatgtgatcatatcatcgccgatcgcatcgcacacccacaaccagacgccaag
gatcttctcaatcctatgttggaaggagtcgacaaggaaactggtgagaaaatgtcgaag
gagctcgtgcgatacaacatggtaacatttctggtggcgggccacgagactacaagcgga
accttggggtttctgttctaccacttgcttaagaatccggaaacatatctcaaagctcag
gccgaagttgatgaagtcattggcgacggtcccttggaggcaaagcatatgtcgcagctc
gtctatatcaagtttgctatatacgaggctctgaggttccttggccctatcgcaatcact
gcgaagcattctttggcgccaacgaaaattgccggtaaataccaggtacagcccgaggac
cacgttctcatgaatctacgcggactgcatcacgatccgaaggtttggggcgaagatgcc
gaagtgttccgaccggacaggttcctcaacggtgggtgggagaacctgcctccaaatgcc
tggaaggcgttcggagacggaatgcgagcctgtatcggcaggacctttgctgagcaagag
atgataatgattgtcgctctcatactacagaagttccaggtcgagttggcagatcccgct
tatcagctccacgtctccgtcaccataacacagaagcccaaggacctgaagatcaaggtg
cgcaggcgacctggccgaactatggcaggcctaggcggggcgagacaaaatgactcacct
cacaaagcaggcacggagaagtccagcccaagtaatgaagcaaacacccccacccgagat
gcaaagccaatcactgtactgtacggctcaaatgcaggtacatgcaagtcgtacgcggaa
gacctagagacaaatgcatctcgcttcggtttcaaagccaacatagccagcttggactct
gccaccgagcatatcccgaaggaccagccgatagtcatcattgagccttcatatgaggga
aaaccagccgataacgctaaaaagttcactgcatggttggagggtaatgcggactccaag
caacttgaaggtgtacgatacgccgtctttggtgtcggcaacagcgactggactcacact
taccatcgtatcccaaagctgacagactcattgttcgagaagatgggcgcaaagagattc
accgagattggccttgtcaatgtgaaagaagacattatgggtccctgggagacatggtcc
gagcaaatgtggaatgatctccgcaaatcgagcggtacaactgttgaagtccttggtggg
caagttgaggttcacataacaccgccgaaatttgcgacgtatctcggaggtaatgacatt
ggctatggagaagtcaaggccaacaaggacttgggcggtggtgaagttggtcttgcaaag
aagcatatggagatcgaacttcccgttgggacatcgtaccgatcgggcgactacatggtt
attttaccgctgaacagcatcacgaatgtgaggcgtatcatgaaacgcttcgatctcgcg
ccagacgacaacatcgtcgttactggaaccaacaagagcttcatcgctaccgattcgcct
atttctatcttcgacctgctcatgacgcgtgtggagttgagcacacccatttcgcagaag
caactccaaacgctcgcagaagcgacacccgaaagcaagcgcaacaagttgttggagctc
gcaacagatgaggtgtacaaaagagatatcatctcaaagcgttacagcatcctggacatc
cttgaagactatcctgactgccagcttgactttgctacctatcttgactctctaaagcct
ctttcacctcgtcaatacagcatctcgtcctcaccgatcgccaacatcgaattcacacag
aagccagatggcaccaacactcagcgcctgacagcctcattgacctatgatatacacgaa
gaagctgcatggagtggaggtggccgccagttccgtggagccgcatccacataccttgct
agacaagagcctggcgaaaaggtccgttgctttacacgcccaacgaacgcgaactttcat
ctgccactcgaccctacagtacccatcatcatgatctgcgcaggctctggtctagccccc
atgcgtggcttcatccaagagcgagcggtgatcaagaaagcccgcaacgcgaccgttggc
ccagcgatcttatactttggctgccgcaaccacgaaaaggatttcatctacgcggacgaa
ctggcgcaatgggaagcggatggcgtcgtcagtgtgcgcgggtgtttttccaaagtcgcg
cccgaagggcaaaaggcccaacgcgtgcctgatcgtatgtgggatgagcgcaaggagttg
gctgcgttgtttggagaacaaggtgcaaagatcttcatttgtggaagcgcaagtaaattg
gcgaagagcactgcggaggtctgtatgaaaatctacatggatactttcccgggtaagacg
gaagatgatgctcaggagtggttggacaaggtcaaggaggataggtatgtcagcgatgtg
tttgagtaa

DBGET integrated database retrieval system